Search Olfactory receptors

Select ORs from

Family: Subfamily:

Chromosome:

OR7E41P Olfactory Receptor

Gene Symbol OR7E41P (View this gene in GeneCards)
Family 7
Subfamily E
Pseudogene Yes
CORP pseudogene probability score
Aliases hg84, OR11-20, OR8-126, HsOR11.6.1P
GeneBank Accessions AF065867, AF399425, NG_002158, U86286
ORDB
Build #39 labels OR7E41P, OR7E50P, OR7E95P
Chromosomal location 11:15,009,254-15,010,187 (-)
Cluster 11@15
Synteny CLIC#0
Remarks

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR7E100P 84.03% 313
OR7E102P 82.69% 312
OR7E116P 80.83% 313

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog cOR7E154 66% 292
Dog cOR7E153 72% 251
Chimp CONTIG110.234-1789 96% 311
Mouse MOR145-1 68% 295
Mouse MOR145-2 64% 311
Mouse MOR145-5 65% 308
Rat NM_001000867 65% 308
Rat NM_001000865 66% 308
Rat NM_001001005 64% 308

Sequence information

Nucleotide sequence TGTCCAAGTCACACAGAGCCACAGAATCTCACAGGTGTCTCAGAATTCCTCCTCCTGGGA
CTCTCAGAGGATCCAGAACTGCAGCCACTCCTTGCTGGGCTGTTCCTATCCATGTGCCTG
GTCACGATGCTGGGGAACCTGCTCATCATCCTGGCCGTCAGCCCTGACTCCCACCTCCAC
ATCCCCATGTACTTCTTCCTCTCCAACCTGTCCTTGCCTGACATTGGTTTCACCTTGGCC
ACGGTCCCCAAGATGATTGTAGACATGCAATCACATAGCAGAGTCATCTCCCATGCAGGC
TGTCTGACACAGATACCTTTCTTTGTCCTTTTTGTATGTATAGATGACATGCTCCTGACT
GTGATGGCCTATGACTGATTTGTGGCCATCTGTCACCCCCTGCACTACCCAGTCATCATG
AATCCTCACCTCTGTGTCTTCTTAGTGTTGATGTCTTTTTCCTTAGCCTGTTGGATTCCT
AGCTGCACAACTGGATTGTTACAATTCACCTGCTTCAAGAATGTGGAAATCTCTAATTTT
TTCTGTGACTGATCTCAACTTCTCAACCTTGCCTGTTCTGACTGTCATCAGTAACATATT
CATACATTTAGATAGTACTATATTTGGTTTTCTTCCCATTTCAGGGATCCTTTTGTCTTA
CTATAAAATTGTGCCCTCCATTCTAAGAATTCCATTGTCAGATGGGAAGTATAAAGCCTT
CTCCACCTGTGGCTCTCACCTGGCAATTGTTTGCTTATTTTATGGAACAGGCATTGGCAT
GTACCTGACTTCAGCTGTGTCACCAGCCCCCAGGAATGGTGTGGTGGCATCAGTGTTGTA
CGCTATGGTCACCCCCATGCTGAACCCCTTCATCTGCAGCCTGAGAAACAGGGGCATTCA
AAGTGCCCTGTGGAGGCTGTGCAGGAGGAAAGTC
Conceptual translation CPSHTEPQNLTGVSEFLLLGLSEDPELQPLLAGLFLSMCLVTMLGNLLIILAVSPDSHLH
IPMYFFLSNLSLPDIGFTLATVPKMIVDMQSHSRVISHAGCLTQIPFFVLFVCIDDMLLT
VMAYDXVAICHPLHYPVIMNPHLCVFLVLM/FFLSLLDSXHNWIV\FTCFKNVEIS
NFFCDXQLLNLACSD\ISNIFIHLDSTIFGFLPISGILLSYYKIVPSILRIPLSDGKY
KAFSTCGSHLAIVCLFYGTGIGMYLTSAVSPAPRNGVVASVLYAMVTPMLNPFICSLRNR
GIQSALWRLCRRKV

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
11 15,009,298 15,009,297 Ins(1) -/C rs34183214 (DbSNP)
11 15,009,340 15,009,340 SNP C/T 1000GP (YRI)
11 15,009,381 15,009,381 SNP G/T 1000GP (YRI)
11 15,009,497 15,009,496 Ins(1) -/T rs34526048 (DbSNP)
11 15,009,721 15,009,721 SNP G/C 1000GP (YRI)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.