Search Olfactory receptors

Select ORs from

Family: Subfamily:

Chromosome:

OR51A2 Olfactory Receptor

Gene Symbol OR51A2 (View this gene in GeneCards)
Family 51
Subfamily A
Pseudogene No
CORP pseudogene probability score
Aliases HsOR11.3.38, ORL3371
GeneBank Accessions AB065797, NM_001004748
ORDB ORL3371
Build #39 labels OR51A2
Chromosomal location 11:4,976,005-4,976,943 (-)
Cluster 11@5
Synteny CLIC#23
Remarks

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR51A4 96.81% 313

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog cOR51A16 87% 305
Chimp CONTIG465.120-3413 96% 313
Mouse MOR8-1 74% 308
Mouse MOR8-3 72% 306
Mouse MOR8-2 68% 310
Rat NM_001001279 71% 308
Rat NM_001000133 73% 299

Expression evidences

Source Accession
mRNA AB528769

Sequence information

Nucleotide sequence ATGTCCATTATCAACACATCATATGTTGAAATCACCACCTTCTTCTTGGTTGGGATGCCA
GGGCTAGAATATGCACACATCTGGATCTCTATCCCCATCTGCAGCATGTATCTTATTGCT
ATTCTAGGAAATGGCACCATTCTTTTTATCATCAAGACAGAGCCCTCCTTGCATGGGCCC
ATGTACTATTTTCTTTCCATGTTGGCTATGTCAGACTTGGGTTTGTCTTTATCATCTCTG
CCCACTGTGTTAAGCATCTTCCTGTTCAATGCCCCTGAAACTTCTTCTAGTGCCTGCTTT
GCCCAGGAATTCTTCATTCATGGATTCTCAGTACTGGAGTCCTCAGTCCTCCTGATCATG
TCATTTGATAGATTCCTAGCCATCCACAATCCTCTGAGATACACCTCAATCCTGACAACT
GTCAGAGTTGCCCAAATAGGGATAGTATTCTCCTTTAAGAGCATGCTCCTGGTTCTTCCC
TTCCCTTTCACTTTAAGAAGCTTGAGATATTGCAAGAAAAACCAATTATCCCATTCCTAC
TGTCTCCACCAGGATGTCATGAAGTTGGCCTGTTCTGACAACAGAATTGATGTTATCTAT
GGCTTTTTTGGAGCACTCTGCCTTATGGTAGACTTTATTCTCATTGCTGTGTCTTACACC
CTGATCCTCAAGACTGTACCGGGAATTGCATCCAAAAAGGAGGAGCTTAAGGCTCTCAAT
ACTTGTGTTTCACACATCTGTGCAGTGATCATCTTCTACCTGCCCATCATCAACCTGGCC
GTTGTCCACCGCTTTGCCGGGCATGTCTCTCCCCTCATTAATGTTCTCATGGCAAATGTT
CTCCTACTTGTACCTCCGCTGATGAAACCAATTGTTTATTGTGTAAAAACTAAACAGATT
AGAGTGAGAGTTGTAGCAAAATTGTGTCAATGGAAGATT
Conceptual translation MSIINTSYVEITTFFLVGMPGLEYAHIWISIPICSMYLIAILGNGTILFIIKTEPSLHGP
MYYFLSMLAMSDLGLSLSSLPTVLSIFLFNAPETSSSACFAQEFFIHGFSVLESSVLLIM
SFDRFLAIHNPLRYTSILTTVRVAQIGIVFSFKSMLLVLPFPFTLRSLRYCKKNQLSHSY
CLHQDVMKLACSDNRIDVIYGFFGALCLMVDFILIAVSYTLILKTVPGIASKKEELKALN
TCVSHICAVIIFYLPIINLAVVHRFAGHVSPLINVLMANVLLLVPPLMKPIVYCVKTKQI
RVRVVAKLCQWKI

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
11 4,976,013 4,976,013 NS A/G W/R rs55827480 (DbSNP), 1000GP (CEU, CHBJPT, YRI)
11 4,976,077 4,976,077 NS T/G K/N rs2570573 (DbSNP), 1000GP (CEU)
11 4,976,081 4,976,081 NS G/A T/M rs2442426 (DbSNP)
11 4,976,086 4,976,086 SYN T/C P/P rs2570572 (DbSNP)
11 4,976,145 4,976,145 NS C/G G/R rs56066301 (DbSNP), 1000GP (CEU)
11 4,976,153 4,976,153 NS C/A R/L rs61744535 (DbSNP)
11 4,976,241 4,976,241 NS C/G E/Q rs2570571 (DbSNP), 1000GP (CEU, YRI)
11 4,976,263 4,976,263 SYN A/C P/P rs74052692 (DbSNP)
11 4,976,264 4,976,264 NS G/A P/L rs2442425 (DbSNP), 1000GP (CEU)
11 4,976,291 4,976,291 NS A/G F/S rs55889636 (DbSNP)
11 4,976,444 4,976,444 NS C/T S/N 1000GP (CEU)
11 4,976,447 4,976,447 NS C/G R/T 1000GP (CEU)
11 4,976,554 4,976,554 SYN G/A N/N rs2595986 (DbSNP), 1000GP (CEU)
11 4,976,654 4,976,654 NS T/C N/S rs3986371 (DbSNP)
11 4,976,656 4,976,656 SYN G/A S/S rs3986370 (DbSNP)
11 4,976,659 4,976,659 SYN A/T S/S rs3986369 (DbSNP)
11 4,976,663 4,976,663 NS G/A T/I rs2595985 (DbSNP), 1000GP (CEU)
11 4,976,668 4,976,668 SYN A/C P/P 1000GP (YRI)
11 4,976,671 4,976,671 SYN G/A A/A rs2595984 (DbSNP), 1000GP (CEU)
11 4,976,768 4,976,768 NS C/T G/E 1000GP (CEU, YRI)
11 4,976,788 4,976,788 NS A/C N/K rs35318834 (DbSNP)
11 4,976,811 4,976,811 NS A/C C/G rs28482315 (DbSNP)

Variations - CNVs

Chr Start End Type Sources
CopyNumber 201 (Hasin)
11 4,907,893 5,135,331 CopyNumber Variation_3835 (DGV)
11 4,946,334 4,979,373 CopyNumber Variation_34970 (DGV)
11 4,950,959 4,997,769 CopyNumber Variation_34971 (DGV)
11 4,952,232 4,977,682 CopyNumber Variation_34973 (DGV)
11 4,959,236 4,985,373 CopyNumber Variation_0413 (DGV), Variation_34974 (DGV)
11 4,961,913 4,992,282 CopyNumber Variation_2900 (DGV)
11 4,966,798 4,976,975 CopyNumber Variation_23184 (DGV)
11 4,966,925 4,977,889 CopyNumber Variation_65847 (DGV)
11 4,967,091 4,976,651 CopyNumber Variation_101113 (DGV)
11 4,967,343 4,976,055 CopyNumber Variation_85627 (DGV)
11 4,967,343 4,977,111 CopyNumber Variation_75525 (DGV)
11 4,967,343 4,980,015 CopyNumber Variation_75523 (DGV), Variation_85626 (DGV)
11 4,967,783 4,993,968 CopyNumber Variation_34975 (DGV)
11 4,967,806 4,977,042 CopyNumber Variation_58515 (DGV)
11 4,967,827 4,976,675 CopyNumber Variation_30538 (DGV)
11 4,967,827 4,978,643 CopyNumber Variation_31803 (DGV)
11 4,968,108 4,977,116 CopyNumber Variation_22813 (DGV)
11 4,968,113 4,977,082 CopyNumber Variation_38836 (DGV)
11 4,968,156 4,976,768 CopyNumber Variation_41249 (DGV)
11 4,968,399 4,976,055 CopyNumber Variation_75524 (DGV), Variation_85625 (DGV)
11 4,974,005 4,977,043 Deletion, CopyNumber #24 (Waszak)
11 4,976,077 4,976,768 InDel Variation_10824 (DGV)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.

K289N E235Q P227L S218F % Freq CORP
1 K E P S 44.78 0.027
2 N E P F 34.41 0.139
3 K Q P S 14.06 0.033
4 K E P F 4.38 0.077
5 K Q P F 1.23 0.092
6 N E P S 0.77 0.052
7 K Q L F 0.23 0.092
8 K Q L S 0.08 0.033
9 N E L F 0.08 0.139

AceView Gene Models

The information is based on AceView gene models, constructed from cDNA sequences. The information might be incomplete.

Accession Type Chr Start End Strand
OR51A2.aApr07-unspliced main_exon 3UTR chr11 4,976,002 4,976,005 -
CDS chr11 4,976,005 4,976,943 -