Search Olfactory receptors

Select ORs from

Family: Subfamily:

Chromosome:

OR8R1P Olfactory Receptor

Gene Symbol OR8R1P (View this gene in GeneCards)
Family 8
Subfamily R
Pseudogene Yes
CORP pseudogene probability score
Aliases ORL3621
GeneBank Accessions NG_004181
ORDB ORL3621
Build #39 labels OR8R1P
Chromosomal location 11:72,960,360-72,960,913 (+)
Cluster 11@73
Synteny CLIC#0
Remarks Disrupted by Alu repeat

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR8B2 51.03% 194
OR8B3 51.03% 194

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog cOR8B3 53% 194
Chimp CONTIG410.166-1029 91% 186
Mouse MOR164-1 53% 198
Mouse MOR164-3 49% 194
Rat NM_001000447 52% 198
Rat NM_001000813 51% 194
Rat NG_003846 46% 197

Expression evidences

Source Accession
ESTs BF957077

Sequence information

Nucleotide sequence TCGCAGCTTTTCTTTCTCTTTATTGTCCTCTCTATAAATACCACGTGTTGATGTTCATAG
CCTGTGGTTGCTTTGTGGCCATCTACAATCCATCATTGCATGAGGTCACCATGTCTCCTC
AGGTGAGAGAGAGAGAGAGACTGGATTTGCTGGAACCACTCCCACACAGGGCACATACTT
AGGCCGACCTTTTGTAGTATTGATGTCATCAACCATCATCTTATGACAGCCTCTTGGTCC
TCTAAGTTTCTTGTACCAGCACCTGTGCCAATGAAGTAGTGGTTTTCACTGTGGTGGGTA
TTAATAGTACAGTATCCAGTCTTTGCTTCTCTTACTTTCATTTAACTTGCTCAAGGCAAA
CTAAAACCTTTCAGCACCTGCAGCTTTCACGTCAATGCCATTTCTGTTTTCTTTGAGTCA
GTGGCATTCATGTATCTCAAATATTTTTCTCCAGGGTCTATGAACCAGGAGATGTTGCTT
TCTGTTTTCTGTTACAATTTGAGGTCTGTGCTGAACTCCCTGTTTAAAGCCTGAGGAACA
AGAAGAATGCTGGT
Conceptual translation SQLFFLFIVLSINTTCXSXVV/FVAIYNPSLHEVTMSPQVR/ERETGFAGTT/HT
GHILRPTFCSIDVINHHL/DSLLVLXSCTSTCANEVVVFTVVGINSTVSSL\SLTFI
XAQGKLKPFSTCSFHVNAISVFFESVAFMYLKYFSPGSMNQEMLLSVFCYNLRSVLNSL
/XLRNKKNAG

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
11 72,960,353 72,960,364 Del(12) -/CCCGGCCTCGCA rs58030947 (DbSNP)
11 72,960,415 72,960,415 SNP C/G 1000GP (YRI)
11 72,960,450 72,960,450 SNP C/T rs59268601 (DbSNP), 1000GP (YRI)
11 72,960,458 72,960,458 SNP C/T rs60779105 (DbSNP), 1000GP (YRI)
11 72,960,492 72,960,499 Del(8) -/GAGAGAGA rs57304893 (DbSNP)
11 72,960,589 72,960,589 SNP C/A 1000GP (YRI)
11 72,960,765 72,960,765 SNP G/T 1000GP (YRI)

Variations - CNVs

Chr Start End Type Sources
11 72,960,260 72,962,913 Deletion #299 (Waszak)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.

AceView Gene Models

The information is based on AceView gene models, constructed from cDNA sequences. The information might be incomplete.

Accession Type Chr Start End Strand
OR8R1P.aApr07-unspliced main_exon CDS_partial chr11 72,960,582 72,960,913 +
3UTR chr11 72,960,913 72,960,961 +