Search Olfactory receptors

Select ORs from

Family: Subfamily:

Chromosome:

OR52E1P Olfactory Receptor

Gene Symbol OR52E1P (View this gene in GeneCards)
Family 52
Subfamily E
Pseudogene Yes
CORP pseudogene probability score
Aliases HsOR11.3.45P
GeneBank Accessions AB065801, NG_003197
ORDB
Build #39 labels OR52E1
Chromosomal location 11:5,090,802-5,091,724 (+)
Cluster 11@5
Synteny CLIC#23
Remarks Segregating Pseudo Gene, a polymorphism of C->del at position 776 (rs5789358)

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR52E2 68.08% 307
OR52E4 65.26% 308
OR52E8 64.47% 304

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog cOR52E8 65% 305
Dog cOR52E4 66% 308
Dog cOR52E2 67% 290
Chimp CONTIG465.107-2273 99% 308
Mouse MOR32-3 67% 303
Mouse MOR32-5 66% 303
Mouse MOR32-2 68% 307
Rat NM_001000747 73% 307
Rat NM_001000138 69% 307
Rat NM_001001270 67% 303

Expression evidences

Source Accession
GNF Atlas2 gnf1h10689_at

Sequence information

Nucleotide sequence ATGAATACCACTCTATTTCATCCTTACTCTTTCCTTCTTCTGGGAATTCCTGGGCTGGAA
AGTATGCATCTCTGGGTTGGTTTTCCTTTCTTTGCTGTGTTCCTGACAGCTGTCCTTGGG
AATATCACCATCCTTTTTGTGATTCAGACTGACAGTAGTCTCCATCATCCCATGTTCTAC
TTCCTGGCCATTCTGTCATCTATTGACCCGGGCCTGTCTACATCCACCATCCCTAAAATG
CTTGGCACCTTCTGGTTTACCCTGAGAGAAATCTCCTTTGAAGGATGCCTTACCCAGATG
TTCTTCATCCACCTGTGCACTGGCATGGAATCAGCTGTGCTTGTGGCCATGGCCTATGAT
TGCTATGTGGCCATCTGTGACCCTCTTTGCTACACGTTGGTGCTGACAAACAAGGTGGTG
TCAGTTATGGCACTGGCCATCTTTCTGAGACCCTTAGTCTTTGTCATACCCTTTGTTCTA
TTTATCCTAAGGCTTCCATTTTGTGGACACCAAATTATTCCTCATACTTACGGTGAGCAC
ATGGGCATTGCCCGCCTGTCTTGTGCCAGCATCAGGGTTAACATCATCTATGGCTTATGT
GCCATCTCTATCCTGGTCTTTGACATCATAGCAATTGTCATTTCCTATGTACAGATCCTT
TGTGCTGTATTTCTACTCTCTTCACATGATGCACGACTCAAGGCATTCAGCACCTGTGGC
TCTCATGTGTGTGTCATGTTGACTTTCTATATGCCTGCATTTTTCTCATTCATGACCATA
GGTTTGGTCGGAATATACCTCACTTTATCCACATTCTTCTGGCTAATTTCTATGTAGTCA
TTCCACCTGCTCTCAACTCTGTAATTTATGGTGTCAGAACCAAACAGATTAGAGCACAAG
TGCTGAAAATGTTTTTCAATAAA
Conceptual translation MNTTLFHPYSFLLLGIPGLESMHLWVGFPFFAVFLTAVLGNITILFVIQTDSSLHHPMFY
FLAILSSIDPGLSTSTIPKMLGTFWFTLREISFEGCLTQMFFIHLCTGMESAVLVAMAYD
CYVAICDPLCYTLVLTNKVVSVMALAIFLRPLVFVIPFVLFILRLPFCGHQIIPHTYGEH
MGIARLSCASIRVNIIYGLCAISILVFDIIAIVISYVQILCAVFLLSSHDARLKAFSTCG
SHVCVMLTFYMPAFFSFMTIGLVGIYLTLS/ILLANFYVVIPPALNSVIYGVRTKQIRA
QVLKMFFNK

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
11 5,091,577 5,091,576 Ins(1) -/C rs5789358 (DbSNP)
11 5,091,579 5,091,578 Ins(1) -/C rs35093737 (DbSNP)
11 5,091,633 5,091,633 SNP A/G rs17352781 (DbSNP), 1000GP (CEU, CHBJPT)
11 5,090,807 5,090,807 SNP A/T rs2445313 (DbSNP), 1000GP (YRI)
11 5,091,332 5,091,332 SNP C/T rs936143 (DbSNP), 1000GP (CEU, CHBJPT, YRI)
11 5,091,563 5,091,563 SNP G/T rs17267785 (DbSNP), 1000GP (CEU, CHBJPT)
11 5,091,496 5,091,496 SNP G/A 1000GP (CEU)
11 5,091,575 5,091,575 SNP G/C 1000GP (CEU)
11 5,091,495 5,091,495 SNP C/T 1000GP (CHBJPT)
11 5,091,175 5,091,175 SNP T/C 1000GP (YRI)

Variations - CNVs

Chr Start End Type Sources
11 4,907,893 5,135,331 CopyNumber Variation_3835 (DGV)
11 5,087,292 5,125,991 CopyNumber Variation_5421 (DGV)
CopyNumber 94 (Hasin)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.