Search Olfactory receptors

Select ORs from

Family: Subfamily:

Chromosome:

OR52N4 Olfactory Receptor

Gene Symbol OR52N4 (View this gene in GeneCards)
Family 52
Subfamily N
Pseudogene No
CORP pseudogene probability score 0.04 (functional)
Aliases OR11-64, HsOR11.3.78, ORL3297
GeneBank Accessions AB065813, BK004385, NM_001005175
ORDB ORL3297
Build #39 labels OR52N4
Chromosomal location 11:5,775,971-5,776,933 (+)
Cluster 11@6
Synteny CLIC#23
Remarks Segregating Pseudo Gene, a nonsynonymous SNP rs4910844 (AA change=R/* )

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR52N1 73.33% 315
OR52N2 72.7% 315
OR52N5 70.16% 305

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog cOR52N2P 76% 287
Dog cOR52N8 85% 250
Chimp CONTIG465.39-8842 98% 321
Mouse MOR34-5 88% 321
Rat NM_001000170 88% 321
Rat NM_001000171 87% 321
Rat NM_001000172 84% 317

Expression evidences

Source Accession
mRNA BC137036

Sequence information

Nucleotide sequence ATGCTAACACTGAATAAAACAGACCTAATACCAGCTTCATTTATTCTGAATGGAGTCCCA
GGACTGGAAGACACACAACTCTGGATTTCCTTCCCATTCTGCTCTATGTATGTTGTGGCT
ATGGTAGGGAATTGTGGACTCCTCTACCTCATTCACTATGAGGATGCCCTGCACAAACCC
ATGTACTACTTCTTGGCCATGCTTTCCTTTACTGACCTTGTTATGTGCTCTAGTACAATC
CCTAAAGCCCTCTGCATCTTCTGGTTTCATCTCAAGGACATTGGATTTGATGAATGCCTT
GTCCAGATGTTCTTCACCCACACCTTCACAGGGATGGAGTCTGGGGTGCTTATGCTTATG
GCCCTGGATCGCTATGTGGCCATCTGCTACCCCTTACGCTATTCAACTATCCTCACCAAT
CCTGTAATTGCAAAGGTTGGGACTGCCACCTTCCTGAGAGGGGTATTACTCATTATTCCC
TTTACTTTCCTCACCAAGCTCCTGCCCTACTGCAGAGGCAATATACTTCCCCATACCTAC
TGTGACCACATGTCTGTAGCCAAATTGTCCTGTGGTAATGTCAAGGTCAATGCCATCTAT
GGTCTGATGGTTGCCCTCCTGATTTGGGGCTTTGACATACTGTGTATCACCAACTCCTAT
ACCATGATTCTCCGGGCAGTGGTCAGCCTCTCCTCAGCAGATGCTCGGCAGAAGGCCTTT
AATACCTGCACTGCCCACATTTGTGCCATTGTTTTCTCCTATACTCCAGCTTTCTTCTCC
TTCTTTTCCCACCGCTTTGGGGAACACATAATCCCCCCTTCTTGCCACATCATTGTAGCC
AATATTTATCTGCTCCTACCACCCACTATGAACCCTATTGTCTATGGGGTGAAAACCAAA
CAGATACGAGACTGTGTCATAAGGATCCTTTCAGGTTCTAAGGATACCAAATCCTACAGC
ATG
Conceptual translation MLTLNKTDLIPASFILNGVPGLEDTQLWISFPFCSMYVVAMVGNCGLLYLIHYEDALHKP
MYYFLAMLSFTDLVMCSSTIPKALCIFWFHLKDIGFDECLVQMFFTHTFTGMESGVLMLM
ALDRYVAICYPLRYSTILTNPVIAKVGTATFLRGVLLIIPFTFLTKLLPYCRGNILPHTY
CDHMSVAKLSCGNVKVNAIYGLMVALLIWGFDILCITNSYTMILRAVVSLSSADARQKAF
NTCTAHICAIVFSYTPAFFSFFSHRFGEHIIPPSCHIIVANIYLLLPPTMNPIVYGVKTK
QIRDCVIRILSGSKDTKSYSM

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
11 5,776,484 5,776,484 nonsense SNP A/T R/* rs4910844 (DbSNP), 1000GP (CEU, CHBJPT, YRI)
11 5,776,623 5,776,623 NS A/T N/I rs7396938 (DbSNP), 1000GP (CEU, CHBJPT, YRI)
11 5,776,287 5,776,287 NS C/T T/I rs7936512 (DbSNP), 1000GP (CEU, CHBJPT, YRI)
11 5,776,779 5,776,779 NS C/T T/I rs73406197 (DbSNP), 1000GP (YRI)
11 5,776,470 5,776,470 NS G/T R/L rs7394584 (DbSNP), 1000GP (CEU, CHBJPT, YRI)
11 5,776,595 5,776,595 NS G/T G/W rs12363178 (DbSNP), 1000GP (CEU, CHBJPT, YRI)
11 5,776,479 5,776,479 NS A/C Y/S 1000GP (CEU, CHBJPT)
11 5,776,927 5,776,927 SYN C/T Y/Y 1000GP (CEU)

Variations - CNVs

Chr Start End Type Sources
11 5,776,623 5,842,356 CopyNumber Variation_2902 (DGV)
11 5,730,377 5,970,717 CopyNumber Variation_3836 (DGV)
11 5,770,370 5,784,484 CopyNumber Variation_6925 (DGV)
11 5,505,764 6,194,475 CopyNumber Variation_34458 (DGV)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.

G95R D123A L167R Y170S R172* N218I I270T N281S S318Y % Freq CORP
1 G D R Y R I I N S 61.83 0.052
2 G D R Y * I I N S 20.28 1.200
3 G D L Y R N I N S 9.37 0.052
4 G D R Y R I T N S 4.53 0.052
5 G D R S R I I N S 1.92 0.181
6 G A R Y R I I N S 0.77 1.000
7 G D R Y R I I S S 0.61 0.052
8 G D L Y R I I N S 0.46 0.052
9 R D R Y R I I N Y 0.15 0.052
10 G D R Y R N I N S 0.08 0.052

AceView Gene Models

The information is based on AceView gene models, constructed from cDNA sequences. The information might be incomplete.

Accession Type Chr Start End Strand
OR52N4.aApr07-unspliced main_exon CDS chr11 5,775,971 5,776,933 +
3UTR chr11 5,776,933 5,776,936 +