Search Olfactory receptors

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Opossum symbols

Opossum Modo-OR10AG13 Olfactory Receptor

Gene Symbol Modo-OR10AG13
Organism Opossum
Family 10
Subfamily AG
Pseudo No
Location scaffold_19209:0-704,916 (+)
Synteny CLIC#174

Sequence information


Nucleotide sequence

ATGGCAGAAATAAATAACACCAATGGAGTGGAATTTGTTTTTGTGGGATTTTCTGACTTT
CCCAATATCCAAGGGTTTTTATTTGGGATTTTCTTAGTCATTTATATAAGTATCCTTATG
GGTAATGGCTTTATTATTGTTATAAGTAAGGTAGATCTATCTCTCCAAACACCCATGTAC
TTTTTCCTGGGACATTTTTCATTTTTGGAAATATGTTATACATCAGTCACTCTTCCCAGA
ATGCTGACCGACCTTTGGAGCCAGAAGAAAAATATTTCTCTGTTGGGTTGTGCTACACAA
CTTTGCTTCTTTCTTATTCTGGGTGTCACTGAGTGCTTACTCCTGGCTTCAATGGCCTAT
GACCGTTATGTGGCCATCTGTAAGCCACTCTACTATTCTCTCATCATGAACTACAAGTCT
TGTGTTCAGCTTGTTGTTGGCTCCTGGATCAGTGGGATCCCACTCCAAATAGGGCAGACA
TACCAGGTATTCTCTTTGTCCTTCTGTGGTTCACACAGACTTAATCATGTTTTCTGTGAC
ATACCTCCATTATTGGAGTCAGCATGTGGGGACACCTCTTTGACTGACTCTTTTGTCTAT
GTTGATATTATCTTCTTTGCTTTGATTCCATTTCTTCTGATACTTGGATCCTATTTCCGA
ATCCTCACCACCATCCAGAAGCTGCCATCAGTCACAGGGAGATCCAAAGCCTTATCTACT
TGTTCTTCTCACCTTATTGTTGTGTGCTTATTTTTTGGTTCTGGTATCATTGCACATTTT
CAAACAAAGTCCAGTAAAACAGCAGGAACAGGAAAAATCTTTTCTCTTTTTTATACTACT
GTAACACCATTGTTTAATCCTTTAATATACAGCCTCAGAAATAAAGATGTCATTGTAGCG
ATTCAGAAATTGTTATCTAAAGAAGGAGGTCTGAGAACCAAA


Conceptual translation

MAEINNTNGVEFVFVGFSDFPNIQGFLFGIFLVIYISILMGNGFIIVISKVDLSLQTPMY
FFLGHFSFLEICYTSVTLPRMLTDLWSQKKNISLLGCATQLCFFLILGVTECLLLASMAY
DRYVAICKPLYYSLIMNYKSCVQLVVGSWISGIPLQIGQTYQVFSLSFCGSHRLNHVFCD
IPPLLESACGDTSLTDSFVYVDIIFFALIPFLLILGSYFRILTTIQKLPSVTGRSKALST
CSSHLIVVCLFFGSGIIAHFQTKSSKTAGTGKIFSLFYTTVTPLFNPLIYSLRNKDVIVA
IQKLLSKEGGLRTK