Search Olfactory receptors

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Opossum symbols

Opossum Modo-OR10AG15P Olfactory Receptor

Gene Symbol Modo-OR10AG15P
Organism Opossum
Family 10
Subfamily AG
Pseudo Yes
Location scaffold_18549:0-2,440,950 (+)
Synteny CLIC#163

Sequence information


Nucleotide sequence

ATGTCAGGTGACAATATCACCTTTGTGGTGGAATTCATTCTCCTAGGATTTTCTGATCTT
CCCAAACTCCAAGGCTTTTTATTTGGAATGTTCTTAAGCATTTACCTATGCATACTGATA
GGAAATGGTCTCCTCATTATCATAACCAAGATTGACCCAGGTCTCCAAACTCCCATGTAT
TTTTTCCTTGGGAACTTTTCCTTCTTGGAAATCTGTTACACATCAGTCACTATCCCCAGA
ATGTTGGCAGATCTCTGGACCCACAAAGGAACCATTTCATTCGTAGCCTGTGCTGTACAA
ACTTGCTTCCTTTACATTCTTGAGAGTTGCAGAGTGCTTGCTTTTAGGTGTGATGGCTTA
TGATCGTTATGTGGCCATCTGTAAGCCTCTCTATTATCCTCTTATCATGAATCACAAGGT
CTGTGTCCAACTGATTGTGGTTTCATGGGTGATTGGGGTTCCAATACTGATTGAAGAGAC
ATACCAGATTTTCTCTCTGAACTTTTGTGGTCCTAACAAACTTAATCATGTTTTCTGTGA
TGCACCACCATTAATAGAGTTGGCGTGTGGAGACACTTATGACATAGAGATTTCTGTCCA
TGTTGCTGCTCTGATATTTGTAATCACCCCCTTTCTATTGATACTCATATCCTATGTAAA
AATAATTACCACCATTCTGAGGCTGCCATCAACACTCAGGGAGATCTAAAGCCTTCTCCA
CTTGTTCTTCTCACCTCATGGGTGGTGGGATTATTCTATGGGTCTGGAAGTATTGTGTAT
TTGCGGCCCAAATCTGGTCACTCAGCAGGATCAGTAAAAGTGTTTGCTCTCTTCTACACC
ACTGTGACCCCAATGTTTAACCCTCTGATATACAGCCTGAGAAATAAAGATGTCATTGCT
GCACTAAGAAAACTACTTCCAAAG


Conceptual translation

MSGDNITFVVEFILLGFSDLPKLQGFLFGMFLSIYLCILIGNGLLIIITKIDPGLQTPMY
FFLGNFSFLEICYTSVTIPRMLADLWTHKGTISFVACAVQTCFLYIL\VAECLLLGVMA
YDRYVAICKPLYYPLIMNHKVCVQLIVVSWVIGVPILIEETYQIFSLNFCGPNKLNHVFC
DAPPLIELACGDTYDIEISVHVAALIFVITPFLLILISYVKIITTILRLPST\GRSKAF
STCSSHLM\VGLFYGSGSIVYLRPKSGHSAGSVKVFALFYTTVTPMFNPLIYSLRNKDV
IAALRKLLPK