Search Olfactory receptors

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Platypus symbols

Platypus oa-OR2B15P Olfactory Receptor

Gene Symbol oa-OR2B15P
Organism Platypus
Family 2
Subfamily B
Pseudo Yes
Location Contig54433:1,571-1,873 (-)
Synteny CLIC#0

Sequence information


Nucleotide sequence

CGCAGGGTGATGGTGGAAACCAGTGAAAATTCCTTTGAGGGATTCATCCTCTTGGGTTTT
TCAGACCAACCCCACCTTGAAGCTGTGCTCTTTACGTGTTTACTCTTTTTCTACCTCCTG
AGTCTGTTGGGCAATATGGCCATCATGGTGGTCTCCCATCTAGATCCTTGTCTCCACATG
CCCTTGCACTTCTTTTCTCTGCTACCCTTTCCTTCCTGGACCTTCTGCTTCTCCACCAGC
CTGGGCCCCCTCAGACTCTAGTGAAACCTGTGGGGGCCCTATAGAAACCCATCACCTTTC
GGG


Conceptual translation

RRVMVETSENSFEGFILLGFSDQPHLEAVLFTCLLFFYLLSLLGNMAIMVVSHLDPCLHM
PLHFFSLLPFPSWTFCFSTSLGPLRL**NLWGPYRNPSPFG