Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

For Blast Search click here

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Opossum symbols

Opossum Modo-OR14C26P Olfactory Receptor

Gene Symbol Modo-OR14C26P
Organism Opossum
Family 14
Subfamily C
Pseudo Yes
Location scaffold_4579:0-7940 (+)

Sequence information


Conceptual translation

MEFSDIGELQILYSFLLFLIYSAGLMGNLPIVMITNFDRTLHTPMYFFLRNLAMVDACYI
SITAPQASVNSLVNNRIISVTGCAAQVFLV*TSKFLRL
HORDE - Developed at the Crown Human Genome Center, Department of Molecular Genetics, the Weizmann Institute of Science | Contact Us