Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

For Blast Search click here

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Opossum symbols

Opossum Modo-OR5BY2P Olfactory Receptor

Gene Symbol Modo-OR5BY2P
Organism Opossum
Family 5
Subfamily BY
Pseudo Yes
Location scaffold_16298:0-1288 (-)

Sequence information


Conceptual translation

KAFSTCVPHIT/VSLFVISGIYVY/QPPSDSGSLKDIIPSVFYTVIPPFMNPIIYSLR
NKQIKDAMGILMKRLF
HORDE - Developed at the Crown Human Genome Center, Department of Molecular Genetics, the Weizmann Institute of Science | Contact Us