Protein information for: OR10A2



MSFSSLPTEIQSLLFLTFLTIYLVTLMGNCLIILVTLADPMLHSPMYFFL
RNLSFLEIGFNLVIVPKMLGTLLAQDTTISFLGCATQMYFFFFFGVAECF
LLATMAYDRYVAICSPLHYPVIMNQRTRAKLAAASWFPGFPVATVQTTWL
FSFPFCGTNKVNHFFCDSPPVLRLVCADTALFEIYAIVGTILVVMIPCLL
ILCSYTHIAAAILKIPSAKGKNKAFSTCSSHLLVVSLFYISLSLTYFRPK
SNNSPEGKKLLSLSYTVMTPMLNPIIYSLRNNEVKNALSRTVSKALALRN
CIP
No N-glycosylation site was found.
In magenta: Conserved cysteines that are predicted to form a disulfide bond.
Underlined and bold: TM regions.

Predicted binding site residues (CDRs) are highlighted according to the following amino acid color code:
| | basic (H,R,K)
| | hydrophilic, no charge (Q,N,T,S)
| | aliphatic (M,A,I,L,V)
| | aromatic (F,Y,W)
| | helix breakers (G,P)
| | acidic (D,E)
| | cysteine (C)

Sequences of the TM regions:

TM

Start position

End position

Sequence

TM1 11 37 QSLLFLTFLTIYLVTLMGNCLIILVTL
TM2 48 70 FFLRNLSFLEIGFNLVIVPKMLG
TM3 85 105 ATQMYFFFFFGVAECFLLATM
TM4 128 148 RAKLAAASWFPGFPVATVQTT
TM5 185 206 YAIVGTILVVMIPCLLILCSYT
TM6 228 252 CSSHLLVVSLFYISLSLTYFRPKSN
TM7 258 277 KKLLSLSYTVMTPMLNPIIY

The information was derived from a multiple alignment of ORs, based on the algorithms of Man et al. Protein Sci. 2004 Jan;13(1):240-54.
HORDE homepage