Protein information for: OR10AB1P



MGNHTAVSLFLLWGFSSFSDLQSLLFVVILSLHVTILAANVSIMGAIKLS
HNLHTPMYFFLCGLSFSETCTTVVVIPRMLVDFLSESKTISLPECATQMF
FFLGFASNNCFIMAAMSYDRYTAIHNPLQYHTLMTRKICLQMMMASWMVG
FLFSLCIIVTVFNLSLCDLNTIQHYFCDISPVVSLACNYTFYHEMAIFVL
SAFVLVGSCILIMISYVFIVFIVIKMPSAKGRSKAFSTCSSHLTVVSIHY
GFACFVYLRPKNSNSFDEDMLTAMIYTILMPLLNPIVYSLRNKEMQIALR
KTLGSVFGVFPQK
In red: predicted N-glycosylation site.
In magenta: Conserved cysteines that are predicted to form a disulfide bond.
Underlined and bold: TM regions.

Predicted binding site residues (CDRs) are highlighted according to the following amino acid color code:
| | basic (H,R,K)
| | hydrophilic, no charge (Q,N,T,S)
| | aliphatic (M,A,I,L,V)
| | aromatic (F,Y,W)
| | helix breakers (G,P)
| | acidic (D,E)
| | cysteine (C)

Sequences of the TM regions:

TM

Start position

End position

Sequence

TM1 22 48 QSLLFVVILSLHVTILAANVSIMGAIK
TM2 59 81 FFLCGLSFSETCTTVVVIPRMLV
TM3 96 116 ATQMFFFLGFASNNCFIMAAM
TM4 139 159 CLQMMMASWMVGFLFSLCIIV
TM5 196 217 AIFVLSAFVLVGSCILIMISYV
TM6 239 263 CSSHLTVVSIHYGFACFVYLRPKNS
TM7 269 288 DMLTAMIYTILMPLLNPIVY

The information was derived from a multiple alignment of ORs, based on the algorithms of Man et al. Protein Sci. 2004 Jan;13(1):240-54.
HORDE homepage