Protein information for: OR10AC1P



MDSPSNATVPCGFLLQGFSEFPHLRPVLFLLLLGVHLATLGGNLLILVAV
ASMPSRQPMLLFLCQLSAIELCYTLVVVPRSLSTXARRGHRSPISFLSCA
FQMQMFVALGGAECFLLAAMAYDRYVAICHPLRYAAVVTPGLCARLALAC
CLRGLAVSVGLTVAIFHLPFCGSRLLLHFFCDITALLHLACTRSYADELP
LLGACLVLLLLPSVLILASYGAIAAALRRLRCPKGRGKAASTCALHLAVT
FLHYGCATFMYVRPRASYSPRLDRTLALVYTNVTPLLCPLIYSLRNREIT
AALSRVLGRRRPGQAP
In red: predicted N-glycosylation site.
In magenta: Conserved cysteines that are predicted to form a disulfide bond.
Underlined and bold: TM regions.

Predicted binding site residues (CDRs) are highlighted according to the following amino acid color code:
| | basic (H,R,K)
| | hydrophilic, no charge (Q,N,T,S)
| | aliphatic (M,A,I,L,V)
| | aromatic (F,Y,W)
| | helix breakers (G,P)
| | acidic (D,E)
| | cysteine (C)

Sequences of the TM regions:

TM

Start position

End position

Sequence

TM1 25 51 RPVLFLLLLGVHLATLGGNLLILVAVA
TM2 61 83 LFLCQLSAIELCYTLVVVPRSLS
TM3 100 120 AFQMQMFVALGGAECFLLAAM
TM4 143 163 CARLALACCLRGLAVSVGLTV
TM5 200 221 PLLGACLVLLLLPSVLILASYG
TM6 243 267 CALHLAVTFLHYGCATFMYVRPRAS
TM7 273 292 DRTLALVYTNVTPLLCPLIY

The information was derived from a multiple alignment of ORs, based on the algorithms of Man et al. Protein Sci. 2004 Jan;13(1):240-54.
HORDE homepage