Protein information for: OR10AE3P



MTELVLLVLSGFGSVRGLLFWAVLCKHLVTLLDNSLIVVLALAASSLRWP
THFLLHHFSLGEVPRHSGGVSDAGRFPSPAALAHRXACFPLLGFFALPGI
AECCLRRAMAFRRCDAICRPLHSTTXGALVFRARFAFTLPFCGACTTRYF
RLDSRPVL
No N-glycosylation site was found.
In magenta: Conserved cysteines that are predicted to form a disulfide bond.
Underlined and bold: TM regions.

Predicted binding site residues (CDRs) are highlighted according to the following amino acid color code:
| | basic (H,R,K)
| | hydrophilic, no charge (Q,N,T,S)
| | aliphatic (M,A,I,L,V)
| | aromatic (F,Y,W)
| | helix breakers (G,P)
| | acidic (D,E)
| | cysteine (C)

Sequences of the TM regions:

TM

Start position

End position

Sequence

TM1 16 42 RGLLFWAVLCKHLVTLLDNSLIVVLAL
TM2 53 75 FLLHHFSLGEVPRHSGGVSDAGR
TM3 89 109 FPLLGFFALPGIAECCLRRAM
TM4 126 139 GALVFRARFAFTLP
TM5 143 157 ACTTRYFRLDSRPVL
TM6 158 157
TM7 158 157

The information was derived from a multiple alignment of ORs, based on the algorithms of Man et al. Protein Sci. 2004 Jan;13(1):240-54.
HORDE homepage