Protein information for: OR10G3



MERINSTLLTAFILTGIPYPLRLRTLFFVFFFLIYILTQLGNLLILITVW
ADPRLHARPMYIFLGVLSVIDMSISSIIVPRLMMNFTLGVKPIPFGGCVA
QLYFYHFLGSTQCFLYTLMAYDRYLAICQPLRYPVLMTAKLSALLVAGAW
MAGSIHGALQAILTFRLPYCGPNQVDYFFCDIPAVLRLACADTTVNELVT
FVDIGVVVASCFSLILLSYIQIIQAILRIHTADGRRRAFSTCGAHVTVVT
VYYVPCAFIYLRPETNSPLDGAAALVPTAITPFLNPLIYTLRNQEVKLAL
KRMLRSPRTPSEV
In red: predicted N-glycosylation site.
In magenta: Conserved cysteines that are predicted to form a disulfide bond.
Underlined and bold: TM regions.

Predicted binding site residues (CDRs) are highlighted according to the following amino acid color code:
| | basic (H,R,K)
| | hydrophilic, no charge (Q,N,T,S)
| | aliphatic (M,A,I,L,V)
| | aromatic (F,Y,W)
| | helix breakers (G,P)
| | acidic (D,E)
| | cysteine (C)

Sequences of the TM regions:

TM

Start position

End position

Sequence

TM1 24 50 RTLFFVFFFLIYILTQLGNLLILITVW
TM2 62 84 IFLGVLSVIDMSISSIIVPRLMM
TM3 99 119 VAQLYFYHFLGSTQCFLYTLM
TM4 142 162 SALLVAGAWMAGSIHGALQAI
TM5 199 220 VTFVDIGVVVASCFSLILLSYI
TM6 242 266 CGAHVTVVTVYYVPCAFIYLRPETN
TM7 271 288 AAALVPTAITPFLNPLIY

The information was derived from a multiple alignment of ORs, based on the algorithms of Man et al. Protein Sci. 2004 Jan;13(1):240-54.
HORDE homepage