Protein information for: OR10G4



MSNASLVTAFILTGLPHAPGLDALLFGIFLVVYVLTVLGNLLILLVIRVD
SHLHTPMYYFLTNLSFIDMWFSTVTVPKMLMTLVSPSGRAISFHSCVAQL
YFFHFLGSTECFLYTVMSYDRYLAISYPLRYTSMMSGSRCALLATGTWLS
GSLHSAVQTILTFHLPYCGPNQIQHYFCDAPPILKLACADTSANVMVIFV
DIGIVASGCFVLIVLSYVSIVCSILRIRTSDGRRRAFQTCASHCIVVLCF
FVPCVVIYLRPGSMDAMDGVVAIFYTVLTPLLNPVVYTLRNKEVKKAVLK
LRDKVAHPQRK
In red: predicted N-glycosylation site.
In magenta: Conserved cysteines that are predicted to form a disulfide bond.
Underlined and bold: TM regions.

Predicted binding site residues (CDRs) are highlighted according to the following amino acid color code:
| | basic (H,R,K)
| | hydrophilic, no charge (Q,N,T,S)
| | aliphatic (M,A,I,L,V)
| | aromatic (F,Y,W)
| | helix breakers (G,P)
| | acidic (D,E)
| | cysteine (C)

Sequences of the TM regions:

TM

Start position

End position

Sequence

TM1 22 48 DALLFGIFLVVYVLTVLGNLLILLVIR
TM2 59 81 YFLTNLSFIDMWFSTVTVPKMLM
TM3 97 117 VAQLYFFHFLGSTECFLYTVM
TM4 140 160 CALLATGTWLSGSLHSAVQTI
TM5 197 218 VIFVDIGIVASGCFVLIVLSYV
TM6 240 264 CASHCIVVLCFFVPCVVIYLRPGSM
TM7 269 286 VVAIFYTVLTPLLNPVVY

The information was derived from a multiple alignment of ORs, based on the algorithms of Man et al. Protein Sci. 2004 Jan;13(1):240-54.
HORDE homepage