Protein information for: OR10G5P



MTAFILMDLPHVPALDAPLFGVFLVVYVLTVLGNLLILLVIRVYSHLHTP
KYYFLTNLSFIDLWFFTVMVPKMPRTLLSLCGKAVSFHSCMTQLYFFYFL
GSTECLLYTVMSYDRYRGNTQHFPVVKTLPTKXAKCXWPGGXHGLPLIIL
ADLSGLTKSXXFLVGNSKLVIXFSYPSEIYYMYRSQHXTLFQTTCTVIIL
SQIIXDIFKFTARFLFMMNMLVVSIDAFLINRFFNFXKYIYIYIVVGSQG
YTVESFIYVSXXYAFVFFCV
No N-glycosylation site was found.
Cysteines that are predicted to form a disulfide bond do not occur.
Underlined and bold: TM regions.

Predicted binding site residues (CDRs) are highlighted according to the following amino acid color code:
| | basic (H,R,K)
| | hydrophilic, no charge (Q,N,T,S)
| | aliphatic (M,A,I,L,V)
| | aromatic (F,Y,W)
| | helix breakers (G,P)
| | acidic (D,E)
| | cysteine (C)

Sequences of the TM regions:

TM

Start position

End position

Sequence

TM1 16 42 DAPLFGVFLVVYVLTVLGNLLILLVIR
TM2 53 75 YFLTNLSFIDLWFFTVMVPKMPR
TM3 91 111 MTQLYFFYFLGSTECLLYTVM
TM4 130 149 PTKXAKCXWPGGXHGLPLII
TM5 155 172 LTKSXXFLVGNSKLVIXF
TM6 195 219 CTVIILSQIIXDIFKFTARFLFMMN
TM7 232 242 FFNFXKYIYIY

The information was derived from a multiple alignment of ORs, based on the algorithms of Man et al. Protein Sci. 2004 Jan;13(1):240-54.
HORDE homepage