Protein information for: OR10J2P



SVLSICCIYPTKRENHTVIREFVFQGFSSFHEHKLTLFVVFLTLCLLTLA
GNVIIVTIISIDRHLHTPMYFFVSMLSTSETVYTLVIVPRMLSSLLSLSQ
PISLGGCATQMFFFITLAINNCFLLTAMGYDRYVAICNPLRYMIIMNKKV
CVQLVCGSCSVGLLVAIVQISSVFRLPFCDKQVAHYFCDIHPVMKLSCVD
TTLHDLINFVVSSLVIVVPLGLVFISYILIISTILKVTSPEGRKKAFATC
ASHLTVVIIHYGCASIAYLKPKSENTRDQDQLISVTYTVFTPLLNPVVYT
LRNKEVKNALHRAIGKKPFA
In red: predicted N-glycosylation site.
In magenta: Conserved cysteines that are predicted to form a disulfide bond.
Underlined and bold: TM regions.

Predicted binding site residues (CDRs) are highlighted according to the following amino acid color code:
| | basic (H,R,K)
| | hydrophilic, no charge (Q,N,T,S)
| | aliphatic (M,A,I,L,V)
| | aromatic (F,Y,W)
| | helix breakers (G,P)
| | acidic (D,E)
| | cysteine (C)

Sequences of the TM regions:

TM

Start position

End position

Sequence

TM1 34 60 KLTLFVVFLTLCLLTLAGNVIIVTIIS
TM2 71 93 FFVSMLSTSETVYTLVIVPRMLS
TM3 108 128 ATQMFFFITLAINNCFLLTAM
TM4 151 171 CVQLVCGSCSVGLLVAIVQIS
TM5 207 228 INFVVSSLVIVVPLGLVFISYI
TM6 250 274 CASHLTVVIIHYGCASIAYLKPKSE
TM7 280 299 DQLISVTYTVFTPLLNPVVY

The information was derived from a multiple alignment of ORs, based on the algorithms of Man et al. Protein Sci. 2004 Jan;13(1):240-54.
HORDE homepage