Protein information for: OR10J9P



VFPLSISFRFRHSSVPRSKSTAVTELFFEGFSSFRXQHRFVFFVVFLTLY
LLTVSGNVIIVTITRLDIHLHTPMYFFLSMLSISETCYMVAITPHMLSRL
LNPHXLIVMQGCVTQLFYVTFGINNCFLLIAMGYDCYVVFCNPLRYSXVR
GLCVWLGSGSLRIGLGMAIVQVTSMFGLPFCDDFVISHFFCDVRPLLKLA
CTDTTVNEIINFVVSVCVLVLHIALIFISYDLIIYTILKIASTEGRKKAC
ATCTSHLIVVISHYGYISIIYLKLKSQSFLGQNRLISVTYTIITPLLNSV
MXILRNKELKDALCRAMKRKLFNPQCIKI
No N-glycosylation site was found.
In magenta: Conserved cysteines that are predicted to form a disulfide bond.
Underlined and bold: TM regions.

Predicted binding site residues (CDRs) are highlighted according to the following amino acid color code:
| | basic (H,R,K)
| | hydrophilic, no charge (Q,N,T,S)
| | aliphatic (M,A,I,L,V)
| | aromatic (F,Y,W)
| | helix breakers (G,P)
| | acidic (D,E)
| | cysteine (C)

Sequences of the TM regions:

TM

Start position

End position

Sequence

TM1 39 65 RFVFFVVFLTLYLLTVSGNVIIVTITR
TM2 76 98 FFLSMLSISETCYMVAITPHMLS
TM3 113 132 VTQLFYVTFGINNCFLLIAM
TM4 153 173 CVWLGSGSLRIGLGMAIVQVT
TM5 210 231 INFVVSVCVLVLHIALIFISYD
TM6 253 277 CTSHLIVVISHYGYISIIYLKLKSQ
TM7 283 302 NRLISVTYTIITPLLNSVMX

The information was derived from a multiple alignment of ORs, based on the algorithms of Man et al. Protein Sci. 2004 Jan;13(1):240-54.
HORDE homepage