Protein information for: OR10N1P



MNMRNHTLLNEFILRGIPQTEGLEAVLCAVFSFIYLFTLLGNLLILIAIV
SSPPMYFFLGRLSTFDILFPSVTCPKMLLYLSGQSPVISFKGCASQLFFY
QLLGSAEGCLYSVMSYDRFVAIHHTLRYMLIMKPGVCVGLVAGAGLVGCL
HATILTSFTFQLSYCGPNQVDYFFCDIPAVLPLACTDSALAQRVGSINVG
FLALTLLISVCVCYTSIGIAILRIRSSEGRQKAFSTCSAHLVAILCAYGP
VIIIYLKSTPNPLLGGQVQILNNVVSPMLNSLIYSLRNKEVKRSLKRVFX
NVLLTVCE
In red: predicted N-glycosylation site.
In magenta: Conserved cysteines that are predicted to form a disulfide bond.
Underlined and bold: TM regions.

Predicted binding site residues (CDRs) are highlighted according to the following amino acid color code:
| | basic (H,R,K)
| | hydrophilic, no charge (Q,N,T,S)
| | aliphatic (M,A,I,L,V)
| | aromatic (F,Y,W)
| | helix breakers (G,P)
| | acidic (D,E)
| | cysteine (C)

Sequences of the TM regions:

TM

Start position

End position

Sequence

TM1 24 50 EAVLCAVFSFIYLFTLLGNLLILIAIV
TM2 57 79 FFLGRLSTFDILFPSVTCPKMLL
TM3 94 114 ASQLFFYQLLGSAEGCLYSVM
TM4 137 157 CVGLVAGAGLVGCLHATILTS
TM5 194 215 VGSINVGFLALTLLISVCVCYT
TM6 237 261 CSAHLVAILCAYGPVIIIYLKSTPN
TM7 266 283 QVQILNNVVSPMLNSLIY

The information was derived from a multiple alignment of ORs, based on the algorithms of Man et al. Protein Sci. 2004 Jan;13(1):240-54.
HORDE homepage