Protein information for: OR10P1



MAGENHTTLPEFLLLGFSDLKALQGPLFWVVLLVYLVTLLGNSLIILLTQ
VSPALHSPMYFFLRQLSVVELFYTTDIVPRTLANLGSPHPQAISFQGCAA
QMYVFIVLGISECCLLTAMAYDRYVAICQPLRYSTLLSPRACMAMVGTSW
LTGIITATTHASLIFSLPFRSHPIIPHFLCDILPVLRLASAGKHRSEISV
MTATIVFIMIPFSLIVTSYIRILGAILAMASTQSRRKVFSTCSSHLLVVS
LFFGTASITYIRPQAGSSVTTDRVLSLFYTVITPMLNPIIYTLRNKDVRR
ALRHLVKRQRPSP
In red: predicted N-glycosylation site.
In magenta: Conserved cysteines that are predicted to form a disulfide bond.
Underlined and bold: TM regions.

Predicted binding site residues (CDRs) are highlighted according to the following amino acid color code:
| | basic (H,R,K)
| | hydrophilic, no charge (Q,N,T,S)
| | aliphatic (M,A,I,L,V)
| | aromatic (F,Y,W)
| | helix breakers (G,P)
| | acidic (D,E)
| | cysteine (C)

Sequences of the TM regions:

TM

Start position

End position

Sequence

TM1 24 50 QGPLFWVVLLVYLVTLLGNSLIILLTQ
TM2 61 83 FFLRQLSVVELFYTTDIVPRTLA
TM3 99 119 AAQMYVFIVLGISECCLLTAM
TM4 142 162 CMAMVGTSWLTGIITATTHAS
TM5 199 220 SVMTATIVFIMIPFSLIVTSYI
TM6 242 266 CSSHLLVVSLFFGTASITYIRPQAG
TM7 272 291 DRVLSLFYTVITPMLNPIIY

The information was derived from a multiple alignment of ORs, based on the algorithms of Man et al. Protein Sci. 2004 Jan;13(1):240-54.
HORDE homepage