Protein information for: OR10R1P



LSSFIFVLCRSISGTKSIKLTSLSEFLLLEFSSLEEIQQILYSVCLWLYL
IVLSGNITTVTVIRLDQSLHIPVYLFLGILSISGTCYTFVILPKMLIDLL
SLLRTISFINCLLQMFFFLGFAVTNFMFLGMTVYDSYVAICHPLHYPVLT
SWQICKQLAATWLXLFFFVCLFSLIGSFLDFQLLFCGPNKINHYFCDISL
LIQLACTDTYIRELVIFIGGILALTVPLILICISYGFIVHTILRIPYVKG
KQKAISTCASHLIMVVVHYGCASFVNLXPSAKXSSSKXPSSKNRLVTVTY
TVVTPLLNPWIYSFKNKNVQMAIWKVICQGGFPPKAIIRLFHI
No N-glycosylation site was found.
In magenta: Conserved cysteines that are predicted to form a disulfide bond.
Underlined and bold: TM regions.

Predicted binding site residues (CDRs) are highlighted according to the following amino acid color code:
| | basic (H,R,K)
| | hydrophilic, no charge (Q,N,T,S)
| | aliphatic (M,A,I,L,V)
| | aromatic (F,Y,W)
| | helix breakers (G,P)
| | acidic (D,E)
| | cysteine (C)

Sequences of the TM regions:

TM

Start position

End position

Sequence

TM1 38 64 QQILYSVCLWLYLIVLSGNITTVTVIR
TM2 75 97 LFLGILSISGTCYTFVILPKMLI
TM3 112 132 LLQMFFFLGFAVTNFMFLGMT
TM4 158 178 LAATWLXLFFFVCLFSLIGSF
TM5 215 236 VIFIGGILALTVPLILICISYG
TM6 258 282 CASHLIMVVVHYGCASFVNLXPSAK
TM7 293 312 NRLVTVTYTVVTPLLNPWIY

The information was derived from a multiple alignment of ORs, based on the algorithms of Man et al. Protein Sci. 2004 Jan;13(1):240-54.
HORDE homepage