Protein information for: OR10S1



MTTENPNQTVVSHFFLEGLRYTAKHSSLFFLLFLLIYSITVAGNLLILLT
VGSDSHLSLPMYHFLGHLSFLDACLSTVTVPKVMAGLLTLDGKVISFEGC
AVQLYCFHFLASTECFLYTVMAYDRYLAICQPLHYPVAMNRRMCAEMAGI
TWAIGATHAAIHTSLTFRLLYCGPCHIAYFFCDIPPVLKLACTDTTINEL
VMLASIGIVAAGCLILIVISYIFIVAAVLRIRTAQGRQRAFSPCTAQLTG
VLLYYVPPVCIYLQPRSSEAGAGAPAVFYTIVTPMLNPFIYTLRNKEVKH
ALQRLLCSSFRESTAGSPPP
In red: predicted N-glycosylation site.
In magenta: Conserved cysteines that are predicted to form a disulfide bond.
Underlined and bold: TM regions.

Predicted binding site residues (CDRs) are highlighted according to the following amino acid color code:
| | basic (H,R,K)
| | hydrophilic, no charge (Q,N,T,S)
| | aliphatic (M,A,I,L,V)
| | aromatic (F,Y,W)
| | helix breakers (G,P)
| | acidic (D,E)
| | cysteine (C)

Sequences of the TM regions:

TM

Start position

End position

Sequence

TM1 26 52 SSLFFLLFLLIYSITVAGNLLILLTVG
TM2 63 85 HFLGHLSFLDACLSTVTVPKVMA
TM3 101 121 AVQLYCFHFLASTECFLYTVM
TM4 144 164 CAEMAGITWAIGATHAAIHTS
TM5 201 222 VMLASIGIVAAGCLILIVISYI
TM6 244 268 CTAQLTGVLLYYVPPVCIYLQPRSS
TM7 273 290 APAVFYTIVTPMLNPFIY

The information was derived from a multiple alignment of ORs, based on the algorithms of Man et al. Protein Sci. 2004 Jan;13(1):240-54.
HORDE homepage