Protein information for: OR10U1P



MFSSEPTIDGNQSLCAKFTFVAFSSIEELQLVLFIVFLIMHLCTIGGNII
IISLIWITPALHTPMYFFLVNLSFLEMCYTTSVVPQLVHLLVETKTISVG
GCATQMYIFAILGLTECCLLAAMAYDRFVAICYPLHYTLFMGPRVCLKLA
AASWFTGVVVESAQITLIFTLPFCGTGKIQHFFCDIMPVLKLACIDTSQI
EIVMFSLSVLFIVSPCFLILCSHMHIPVTILRIPSAAGRHKAFSTCSSHI
LVVSLFYGTALFTYLQPKTAHTPETDKATALMYTMVTPALNPVIYTLRNK
EVKEAFQRITQRNSLRQTA
In red: predicted N-glycosylation site.
In magenta: Conserved cysteines that are predicted to form a disulfide bond.
Underlined and bold: TM regions.

Predicted binding site residues (CDRs) are highlighted according to the following amino acid color code:
| | basic (H,R,K)
| | hydrophilic, no charge (Q,N,T,S)
| | aliphatic (M,A,I,L,V)
| | aromatic (F,Y,W)
| | helix breakers (G,P)
| | acidic (D,E)
| | cysteine (C)

Sequences of the TM regions:

TM

Start position

End position

Sequence

TM1 30 56 QLVLFIVFLIMHLCTIGGNIIIISLIW
TM2 67 89 FFLVNLSFLEMCYTTSVVPQLVH
TM3 103 123 ATQMYIFAILGLTECCLLAAM
TM4 146 166 CLKLAAASWFTGVVVESAQIT
TM5 203 224 VMFSLSVLFIVSPCFLILCSHM
TM6 246 270 CSSHILVVSLFYGTALFTYLQPKTA
TM7 276 295 DKATALMYTMVTPALNPVIY

The information was derived from a multiple alignment of ORs, based on the algorithms of Man et al. Protein Sci. 2004 Jan;13(1):240-54.
HORDE homepage