Protein information for: OR10W1



MEFVFLAYPSCPELHILSFLGVSLVYGLIITGNILIVVSIHTETCLCTSM
YYFLGSLSGIEICYTAVVVPHILANTLQSEKTITLLGCATQMAFFIALGS
ADCFLLAAMAYDRYVAICHPLQYPLLMTLTLCVHLVVASVISGLFLSLQL
VAFIFSLPFCQAQGIEHFFCDVPPVMHVVCAQSHIHEQSVLVAAILAIAV
PFFLITTSYTFIVAALLKIHSAAGRHRAFSTCSSHLTVVLLQYGCCAFMY
LCPSSSYNPKQDRFISLVYTLGTPLLNPLIYALRNSEMKGAVGRVLTRNC
LSQNS
No N-glycosylation site was found.
In magenta: Conserved cysteines that are predicted to form a disulfide bond.
Underlined and bold: TM regions.

Predicted binding site residues (CDRs) are highlighted according to the following amino acid color code:
| | basic (H,R,K)
| | hydrophilic, no charge (Q,N,T,S)
| | aliphatic (M,A,I,L,V)
| | aromatic (F,Y,W)
| | helix breakers (G,P)
| | acidic (D,E)
| | cysteine (C)

Sequences of the TM regions:

TM

Start position

End position

Sequence

TM1 15 41 HILSFLGVSLVYGLIITGNILIVVSIH
TM2 52 74 YFLGSLSGIEICYTAVVVPHILA
TM3 89 109 ATQMAFFIALGSADCFLLAAM
TM4 132 152 CVHLVVASVISGLFLSLQLVA
TM5 189 210 SVLVAAILAIAVPFFLITTSYT
TM6 232 256 CSSHLTVVLLQYGCCAFMYLCPSSS
TM7 262 281 DRFISLVYTLGTPLLNPLIY

The information was derived from a multiple alignment of ORs, based on the algorithms of Man et al. Protein Sci. 2004 Jan;13(1):240-54.
HORDE homepage