Protein information for: OR10Y1P



MEEENQRGVVHFHFHFFSTDLVVASFIIVALMLHQVSLVGHFTFGPTVWQ
DPFLHIPMYLFLSALTMLEIGYSTNISPPTLATVLYMGKMLISLPGYGTQ
MLFVILLRGSECVLLAVMAYDRYITICHPFNYNLIMSGXLCGQMTLGSLR
LGFLLSLFLTMLIXHPPFCGSNETYHFFCDMPTASAWSVQTPHAXVSSLT
SVWPPSPSPSFLLVCLPYGCLAATILRMHSAKRKHXAFSTSSSHLIVVLL
KYWCCILICLCPSSSYSPEEGWEVSLVHTVFLPVWNPLIYSVWNQDVTDA
VERLVARMSLFXQPEIFLLKKYFP
No N-glycosylation site was found.
Cysteines that are predicted to form a disulfide bond do not occur.
Underlined and bold: TM regions.

Predicted binding site residues (CDRs) are highlighted according to the following amino acid color code:
| | basic (H,R,K)
| | hydrophilic, no charge (Q,N,T,S)
| | aliphatic (M,A,I,L,V)
| | aromatic (F,Y,W)
| | helix breakers (G,P)
| | acidic (D,E)
| | cysteine (C)

Sequences of the TM regions:

TM

Start position

End position

Sequence

TM1 18 39 TDLVVASFIIVALMLHQVSLVG
TM2 52 73 PFLHIPMYLFLSALTMLEIGYS
TM3 89 109 KMLISLPGYGTQMLFVILLRG
TM4 134 151 IMSGXLCGQMTLGSLRLG
TM5 189 210 VQTPHAXVSSLTSVWPPSPSPS
TM6 232 256 KRKHXAFSTSSSHLIVVLLKYWCCI
TM7 270 280 GWEVSLVHTVF

The information was derived from a multiple alignment of ORs, based on the algorithms of Man et al. Protein Sci. 2004 Jan;13(1):240-54.
HORDE homepage