Protein information for: OR11G1P



IFNTPSNSSTFTGFILLGFPCPREGQILLVVLFTVVYLLTLMGNGSIILC
CALGQRLHAPMYILLANFSFLEICYVTSTVPNVLANFLSXHKIISFSGCF
LQFYFFFSLGSTECFFLGAMAFDLYLAICRPLRYPTIMTRRLCNILVGSC
WVLGFLWFLIPISVISQMTCGSRIIDHFPCDPGPLLALTCTRAPLLELTS
STLSSLLLFIPFLFIVGCYALVLRAVLRVPSASGRRKAFSTCGSHLAVVS
LFYGSMMITYVSPTSGHEFGMQKTVTLFYSVVTPLINPVIYSLRNKEMKH
AMRNYTVMFYFLEFIGLQ
In red: predicted N-glycosylation site.
In magenta: Conserved cysteines that are predicted to form a disulfide bond.
Underlined and bold: TM regions.

Predicted binding site residues (CDRs) are highlighted according to the following amino acid color code:
| | basic (H,R,K)
| | hydrophilic, no charge (Q,N,T,S)
| | aliphatic (M,A,I,L,V)
| | aromatic (F,Y,W)
| | helix breakers (G,P)
| | acidic (D,E)
| | cysteine (C)

Sequences of the TM regions:

TM

Start position

End position

Sequence

TM1 26 52 QILLVVLFTVVYLLTLMGNGSIILCCA
TM2 63 85 ILLANFSFLEICYVTSTVPNVLA
TM3 100 120 FLQFYFFFSLGSTECFFLGAM
TM4 143 163 CNILVGSCWVLGFLWFLIPIS
TM5 199 220 TSSTLSSLLLFIPFLFIVGCYA
TM6 242 266 CGSHLAVVSLFYGSMMITYVSPTSG
TM7 272 291 QKTVTLFYSVVTPLINPVIY

The information was derived from a multiple alignment of ORs, based on the algorithms of Man et al. Protein Sci. 2004 Jan;13(1):240-54.
HORDE homepage