Protein information for: OR11H3P



MNVSEPNSSFALVNEFILQDLSFEWTIQIFLFSLFTTTYALTITGNGAIA
CALWCDRRRHTPMYMFLGNFSFLEIWYVSSTVPKMLVNFLSEKKTISFAG
CFLQFYFFFSLGTSECLILTVMAFDQYLVICHPLHYAXXIMTGHLCAKLV
ILCWVCGFLCFLIPTVLISQMPFCGPNINDHVVCDPGPLFALACVSAPRI
QLFCYTLSSLVIFGNFLFIIGSYTLVLKAVLGMPSSTGKHKAFSTCGSHL
AVVSLFYGSLMVMCVSPGLGHSMGMQKIKTLFYAMVTPLFNPLIYSLQNK
EIKAALRKVLGSSNII
In red: predicted N-glycosylation site.
In magenta: Conserved cysteines that are predicted to form a disulfide bond.
Underlined and bold: TM regions.

Predicted binding site residues (CDRs) are highlighted according to the following amino acid color code:
| | basic (H,R,K)
| | hydrophilic, no charge (Q,N,T,S)
| | aliphatic (M,A,I,L,V)
| | aromatic (F,Y,W)
| | helix breakers (G,P)
| | acidic (D,E)
| | cysteine (C)

Sequences of the TM regions:

TM

Start position

End position

Sequence

TM1 28 54 QIFLFSLFTTTYALTITGNGAIACALW
TM2 65 87 MFLGNFSFLEIWYVSSTVPKMLV
TM3 102 122 FLQFYFFFSLGTSECLILTVM
TM4 146 166 CAKLVILCWVCGFLCFLIPTV
TM5 203 224 FCYTLSSLVIFGNFLFIIGSYT
TM6 246 270 CGSHLAVVSLFYGSLMVMCVSPGLG
TM7 276 295 QKIKTLFYAMVTPLFNPLIY

The information was derived from a multiple alignment of ORs, based on the algorithms of Man et al. Protein Sci. 2004 Jan;13(1):240-54.
HORDE homepage