Protein information for: OR11H5P



MTEFVLLGFPGCQEMQSFLFSLFFVIYVFTIIGNGTIVCAVRLDKRLHTP
MYILLGNFAFLEIRXVTSTVPNMLVNFLSETKTISFVGCFLQFYFFTSLG
TIEAYFLCIMAYDRYLAICRPLHYPTIMTPQLCYILMSFCWVFGFLSYSV
STVQLSQLPFCGPNIINHFLCDMDPLMALSCASAPITEIIFYILSSLIII
LTLLYICGSYMRLLIAVLKVPSAAGQQKAFSTCGSHLTVVCLFFGALLAM
YVSPTTDNPAAIXKIITLFYSVVTPFLNPLIYSLRNKEMKAALKKVLRIE
No N-glycosylation site was found.
In magenta: Conserved cysteines that are predicted to form a disulfide bond.
Underlined and bold: TM regions.

Predicted binding site residues (CDRs) are highlighted according to the following amino acid color code:
| | basic (H,R,K)
| | hydrophilic, no charge (Q,N,T,S)
| | aliphatic (M,A,I,L,V)
| | aromatic (F,Y,W)
| | helix breakers (G,P)
| | acidic (D,E)
| | cysteine (C)

Sequences of the TM regions:

TM

Start position

End position

Sequence

TM1 16 42 QSFLFSLFFVIYVFTIIGNGTIVCAVR
TM2 53 75 ILLGNFAFLEIRXVTSTVPNMLV
TM3 90 110 FLQFYFFTSLGTIEAYFLCIM
TM4 133 153 CYILMSFCWVFGFLSYSVSTV
TM5 190 211 IFYILSSLIIILTLLYICGSYM
TM6 233 257 CGSHLTVVCLFFGALLAMYVSPTTD
TM7 263 281 KIITLFYSVVTPFLNPLIY

The information was derived from a multiple alignment of ORs, based on the algorithms of Man et al. Protein Sci. 2004 Jan;13(1):240-54.
HORDE homepage