Protein information for: OR11H6



MHFVTEFVLLGFHGQREMQSCFFSFILVLYLLTLLGNGAIVCAVKLDRRL
HTPMYILLGNFAFLEIWYISSTVPNMLVNILSEIKTISFSGCFLQFYFFF
SLGTTECFFLSVMAYDRYLAICRPLHYPSIMTGKFCIILVCVCWVGGFLC
YPVPIVLISQLPFCGPNIIDHLVCDPGPLFALACISAPSTELICYTFNSM
IIFGPFLSILGSYTLVIRAVLCIPSGAGRTKAFSTCGSHLMVVSLFYGTL
MVMYVSPTSGNPAGMQKIITLVYTAMTPFLNPLIYSLRNKDMKDALKRVL
GLTVSQN
No N-glycosylation site was found.
In magenta: Conserved cysteines that are predicted to form a disulfide bond.
Underlined and bold: TM regions.

Predicted binding site residues (CDRs) are highlighted according to the following amino acid color code:
| | basic (H,R,K)
| | hydrophilic, no charge (Q,N,T,S)
| | aliphatic (M,A,I,L,V)
| | aromatic (F,Y,W)
| | helix breakers (G,P)
| | acidic (D,E)
| | cysteine (C)

Sequences of the TM regions:

TM

Start position

End position

Sequence

TM1 19 45 QSCFFSFILVLYLLTLLGNGAIVCAVK
TM2 56 78 ILLGNFAFLEIWYISSTVPNMLV
TM3 93 113 FLQFYFFFSLGTTECFFLSVM
TM4 136 156 CIILVCVCWVGGFLCYPVPIV
TM5 193 214 ICYTFNSMIIFGPFLSILGSYT
TM6 236 260 CGSHLMVVSLFYGTLMVMYVSPTSG
TM7 266 285 QKIITLVYTAMTPFLNPLIY

The information was derived from a multiple alignment of ORs, based on the algorithms of Man et al. Protein Sci. 2004 Jan;13(1):240-54.
HORDE homepage