Protein information for: OR11I1P



MVILSWENQTMRVEFVLQGFSSIRQLNIFLFMIILVFYILTVSGNILIVL
LVLVRHHLHTPMYFLLVNLSCLEIWYTSNIIPKMLLIIIAEXKTISVAGW
LAQFYFFGSLAATECLLLTVMSYDRYLAICQPLCYRVLMTGPLCIRLAAG
SWFCCFLLTAITMVLLCRLTFCGPYETDHFFCDFTPLVHLSCMDTSVTET
IAFATSSAVTLIPFLLIVASYSCVLSAILRIPSCTGQKKAFSTCSSHLTV
VIVFYGTLIATYLVPSANSSQLLCKGSSLLYIILTPMFNPIIYSLRNRDI
HEALKKCLRKKSGVCLR
In red: predicted N-glycosylation site.
Cysteines that are predicted to form a disulfide bond do not occur.
Underlined and bold: TM regions.

Predicted binding site residues (CDRs) are highlighted according to the following amino acid color code:
| | basic (H,R,K)
| | hydrophilic, no charge (Q,N,T,S)
| | aliphatic (M,A,I,L,V)
| | aromatic (F,Y,W)
| | helix breakers (G,P)
| | acidic (D,E)
| | cysteine (C)

Sequences of the TM regions:

TM

Start position

End position

Sequence

TM1 27 53 NIFLFMIILVFYILTVSGNILIVLLVL
TM2 64 86 FLLVNLSCLEIWYTSNIIPKMLL
TM3 101 121 LAQFYFFGSLAATECLLLTVM
TM4 144 164 CIRLAAGSWFCCFLLTAITMV
TM5 201 222 IAFATSSAVTLIPFLLIVASYS
TM6 244 268 CSSHLTVVIVFYGTLIATYLVPSAN
TM7 274 293 CKGSSLLYIILTPMFNPIIY

The information was derived from a multiple alignment of ORs, based on the algorithms of Man et al. Protein Sci. 2004 Jan;13(1):240-54.
HORDE homepage