Protein information for: OR11J5P



MSVVEANNISGPVSEFILLGFPSCCRETKILLFVVFSLIYLLTLMGNTSI
ICAVWSSQKLHTPMYILLANFSFLEICCISVXCPKMLANLISHIKSISYA
GCLLQFFYFSMCAAEGYFLSVMSFDRFLTICRPLHYPTVMTHHLCVXLVA
FCRAGGFLSILMPAVLMSRVPFCGPNITDHFFCNLGPLLALSCAPVPKTT
LTCATVSSLIIFITFLYILGSHILVLRAVLWVPAGSGRNKAFSTCASHFL
VVSFFYGSVMVMYVSPGSRSRPGTQKFVTLFYCTATPFFNPLTYSLWNKD
MTDALKKVLGVPSKEISWNT
In red: predicted N-glycosylation site.
In magenta: Conserved cysteines that are predicted to form a disulfide bond.
Underlined and bold: TM regions.

Predicted binding site residues (CDRs) are highlighted according to the following amino acid color code:
| | basic (H,R,K)
| | hydrophilic, no charge (Q,N,T,S)
| | aliphatic (M,A,I,L,V)
| | aromatic (F,Y,W)
| | helix breakers (G,P)
| | acidic (D,E)
| | cysteine (C)

Sequences of the TM regions:

TM

Start position

End position

Sequence

TM1 29 55 KILLFVVFSLIYLLTLMGNTSIICAVW
TM2 66 88 ILLANFSFLEICCISVXCPKMLA
TM3 103 122 LLQFFYFSMCAAEGYFLSVM
TM4 145 165 CVXLVAFCRAGGFLSILMPAV
TM5 202 223 TCATVSSLIIFITFLYILGSHI
TM6 245 269 CASHFLVVSFFYGSVMVMYVSPGSR
TM7 275 294 QKFVTLFYCTATPFFNPLTY

The information was derived from a multiple alignment of ORs, based on the algorithms of Man et al. Protein Sci. 2004 Jan;13(1):240-54.
HORDE homepage