Protein information for: OR11K1P



METINFVSCLILMGFPSSPEMQLLYFGLFSVAYTLTPMGNAAIVCAVWXD
QHLHTPMYTLLGNFSLLEICYVTATKLLANFLSTSKSISFMSCFAQFYFF
SLGYDEGFFLCITAFDRYLAICRPLRYPCIMTKQVCTGLIIFAWSCVFVI
FLTLVILISQLSYCGPNIINHFICDPVPLKMLSCSEDIIITQLIYSTFNS
VFIIGTFLFILCSALVILAIIRMPSEAGKRKAFSTCASHLAVVTLFYGSI
MVMYVSPGSAHSSKNEKIITLFFSVITPLCNPLIYSLRNKEMKDYLRKIF
RTGKDVNKI
No N-glycosylation site was found.
In magenta: Conserved cysteines that are predicted to form a disulfide bond.
Underlined and bold: TM regions.

Predicted binding site residues (CDRs) are highlighted according to the following amino acid color code:
| | basic (H,R,K)
| | hydrophilic, no charge (Q,N,T,S)
| | aliphatic (M,A,I,L,V)
| | aromatic (F,Y,W)
| | helix breakers (G,P)
| | acidic (D,E)
| | cysteine (C)

Sequences of the TM regions:

TM

Start position

End position

Sequence

TM1 22 48 QLLYFGLFSVAYTLTPMGNAAIVCAVW
TM2 59 79 TLLGNFSLLEICYVTATKLLA
TM3 94 113 FAQFYFFSLGYDEGFFLCIT
TM4 136 156 CTGLIIFAWSCVFVIFLTLVI
TM5 193 214 LIYSTFNSVFIIGTFLFILCSA
TM6 236 260 CASHLAVVTLFYGSIMVMYVSPGSA
TM7 266 285 EKIITLFFSVITPLCNPLIY

The information was derived from a multiple alignment of ORs, based on the algorithms of Man et al. Protein Sci. 2004 Jan;13(1):240-54.
HORDE homepage