Protein information for: OR11M1P



PLFSWAQTWKKKQSSGDSGNQTTWLILVGFGELQYLGFLPFTLFLAIYVV
TVGGNALIMLAVASSRTLHPPMYFFLCHFSLLEIGYTSNVILWLLQSFLE
GKEVISLVSCLAQFYVFSSLAAAECLLLSAVSYDCYLAICCPLHYPALMS
TWFCHCLAAGAWFSGFFSSAFTMALAAPLSWHREIDHYFCEFAPVVRQFC
GDVGVMXGAEVSISGFLTLAAFLLIVASSAFIEAVLQIPSGHERQKAFFT
CSSHLTVVGVFYGTLIVVYVAPIEPHVPLLLKVFSVLYTVFTPMVNSIIH
SLKNQEVKGALHRLRGQLIPGHTH
In red: predicted N-glycosylation site.
In magenta: Conserved cysteines that are predicted to form a disulfide bond.
Underlined and bold: TM regions.

Predicted binding site residues (CDRs) are highlighted according to the following amino acid color code:
| | basic (H,R,K)
| | hydrophilic, no charge (Q,N,T,S)
| | aliphatic (M,A,I,L,V)
| | aromatic (F,Y,W)
| | helix breakers (G,P)
| | acidic (D,E)
| | cysteine (C)

Sequences of the TM regions:

TM

Start position

End position

Sequence

TM1 37 63 GFLPFTLFLAIYVVTVGGNALIMLAVA
TM2 74 96 FFLCHFSLLEIGYTSNVILWLLQ
TM3 111 131 LAQFYVFSSLAAAECLLLSAV
TM4 154 174 CHCLAAGAWFSGFFSSAFTMA
TM5 209 230 AEVSISGFLTLAAFLLIVASSA
TM6 251 275 CSSHLTVVGVFYGTLIVVYVAPIEP
TM7 281 300 LKVFSVLYTVFTPMVNSIIH

The information was derived from a multiple alignment of ORs, based on the algorithms of Man et al. Protein Sci. 2004 Jan;13(1):240-54.
HORDE homepage