Protein information for: OR11N1P



MAGTEEENTIQISEIIFLGFGDLHGLQFLLFGIFLAIYVVTVMGNIAISV
VSANHFLHTPMFFFLGHFFLEIGCTSTIEPMRLRTAISSYAFLLSSLCFP
VLLFALVATECFFLAVMSYDCYIATCNPLQYFSIMDHWSCLQLASASWVA
GFLAFTLLIVLIFHLTFCSTNVVEHFRDLKPIMKLVCTDTEVAQMTSFIC
TSLFVLGPFLLTLASYDHIITAVLRIPSATGKQRAFSTCSSHQTVVSLYY
GVLSIVYGFPSRLIEVLYEDLLKLLSILYTVLTPALNHIIYTLRNKDGKV
VLRKLVQXGTYNWSKKSLKFLVAFGTF
No N-glycosylation site was found.
Cysteines that are predicted to form a disulfide bond do not occur.
Underlined and bold: TM regions.

Predicted binding site residues (CDRs) are highlighted according to the following amino acid color code:
| | basic (H,R,K)
| | hydrophilic, no charge (Q,N,T,S)
| | aliphatic (M,A,I,L,V)
| | aromatic (F,Y,W)
| | helix breakers (G,P)
| | acidic (D,E)
| | cysteine (C)

Sequences of the TM regions:

TM

Start position

End position

Sequence

TM1 27 52 QFLLFGIFLAIYVVTVMGNIAISVVS
TM2 63 84 FFLGHFFLEIGCTSTIEPMRLR
TM3 99 117 FPVLLFALVATECFFLAVM
TM4 140 160 CLQLASASWVAGFLAFTLLIV
TM5 196 217 TSFICTSLFVLGPFLLTLASYD
TM6 239 263 CSSHQTVVSLYYGVLSIVYGFPSRL
TM7 272 291 LKLLSILYTVLTPALNHIIY

The information was derived from a multiple alignment of ORs, based on the algorithms of Man et al. Protein Sci. 2004 Jan;13(1):240-54.
HORDE homepage