Protein information for: OR12D1P



MLNTTSVTEFLLLGVTDIQELQPFLFVVFLTIYFISVAGNGAILMIVISD
PRLHSPMYFFLGNLSCLDICYSSVTLPKMLQNFLSAHKAISFLGCISQLH
FFHFLGSTEAMLLAVMAFDRFVAICKPLRYTVIMNPQLCTQMAITIWMIG
FFHALLHSLMTSRLNFCGSNRIYHFFCDVKPLLKLSCNQWLLSTVTGTIA
MGPFFLTLLSYFYIITHLFFKTHSFSMLRKALSTCASHFMVVILLYAPVL
FTYIHHASGTSMDQDRITAIMYTVVTPVLNPLIYTLRNKEVKGAFNRAMK
RWLWPKEILK
In red: predicted N-glycosylation site.
In magenta: Conserved cysteines that are predicted to form a disulfide bond.
Underlined and bold: TM regions.

Predicted binding site residues (CDRs) are highlighted according to the following amino acid color code:
| | basic (H,R,K)
| | hydrophilic, no charge (Q,N,T,S)
| | aliphatic (M,A,I,L,V)
| | aromatic (F,Y,W)
| | helix breakers (G,P)
| | acidic (D,E)
| | cysteine (C)

Sequences of the TM regions:

TM

Start position

End position

Sequence

TM1 22 48 QPFLFVVFLTIYFISVAGNGAILMIVI
TM2 59 81 FFLGNLSCLDICYSSVTLPKMLQ
TM3 96 116 ISQLHFFHFLGSTEAMLLAVM
TM4 139 159 CTQMAITIWMIGFFHALLHSL
TM5 191 212 LLSTVTGTIAMGPFFLTLLSYF
TM6 235 259 CASHFMVVILLYAPVLFTYIHHASG
TM7 265 284 DRITAIMYTVVTPVLNPLIY

The information was derived from a multiple alignment of ORs, based on the algorithms of Man et al. Protein Sci. 2004 Jan;13(1):240-54.
HORDE homepage