Protein information for: OR12D3



MENVTTMNEFLLLGLTGVQELQPFFFGIFLIIYLINLIGNGSILVMVVLE
PQLHSPMYFFLGNLSCLDISYSSVTLPKLLVNLVCSRRAISFLGCITQLH
FFHFLGSTEAILLAIMAFDRFVAICNPLRYTVIMNPQVCILLAAAAWLIS
FFYALMHSVMTAHLSFCGSQKLNHFFYDVKPLLELACSDTLLNQWLLSIV
TGSISMGAFFLTLLSCFYVIGFLLFKNRSCRILHKALSTCASHFMVVCLF
YGPVGFTYIRPASATSMIQDRIMAIMYSAVTPVLNPLIYTLRNKEVMMAL
KKIFGRKLFKDWQQHH
In red: predicted N-glycosylation site.
Cysteines that are predicted to form a disulfide bond do not occur.
Underlined and bold: TM regions.

Predicted binding site residues (CDRs) are highlighted according to the following amino acid color code:
| | basic (H,R,K)
| | hydrophilic, no charge (Q,N,T,S)
| | aliphatic (M,A,I,L,V)
| | aromatic (F,Y,W)
| | helix breakers (G,P)
| | acidic (D,E)
| | cysteine (C)

Sequences of the TM regions:

TM

Start position

End position

Sequence

TM1 22 48 QPFFFGIFLIIYLINLIGNGSILVMVV
TM2 59 81 FFLGNLSCLDISYSSVTLPKLLV
TM3 96 116 ITQLHFFHFLGSTEAILLAIM
TM4 139 159 CILLAAAAWLISFFYALMHSV
TM5 196 217 LLSIVTGSISMGAFFLTLLSCF
TM6 240 264 CASHFMVVCLFYGPVGFTYIRPASA
TM7 270 289 DRIMAIMYSAVTPVLNPLIY

The information was derived from a multiple alignment of ORs, based on the algorithms of Man et al. Protein Sci. 2004 Jan;13(1):240-54.
HORDE homepage