Protein information for: OR13C6P



MVSSNQTSPVLGFLLLGLSAHPKLEKTFFVLILLMYLVILLGNGVLILVT
ILDSRLDTPMYFFLGNLSFLDICYTTSSSLISFLTPRKTISFSACAVQMF
LSLAMGATECVLLSMMAFDRYVAICNPLWYPEVMNKATYVPMAAGSWVAG
SLTAMVQTPLALRLPFCGDNIINHFTCEILAVLKLACADISVNVISMGVA
NVIFLGVPVLFISFSYVFIIATILRIPSAEGRKKAFSTCSAHLTVVIVFY
GTILFMYGKPKSKDPLGADKQDLADKLISLFYGVVTPMLNPIIYSLRNKE
VKAAVRNLVFQKRFLQ
In red: predicted N-glycosylation site.
In magenta: Conserved cysteines that are predicted to form a disulfide bond.
Underlined and bold: TM regions.

Predicted binding site residues (CDRs) are highlighted according to the following amino acid color code:
| | basic (H,R,K)
| | hydrophilic, no charge (Q,N,T,S)
| | aliphatic (M,A,I,L,V)
| | aromatic (F,Y,W)
| | helix breakers (G,P)
| | acidic (D,E)
| | cysteine (C)

Sequences of the TM regions:

TM

Start position

End position

Sequence

TM1 25 51 EKTFFVLILLMYLVILLGNGVLILVTI
TM2 62 81 FFLGNLSFLDICYTTSSSLI
TM3 96 116 AVQMFLSLAMGATECVLLSMM
TM4 139 159 YVPMAAGSWVAGSLTAMVQTP
TM5 196 217 SMGVANVIFLGVPVLFISFSYV
TM6 239 263 CSAHLTVVIVFYGTILFMYGKPKSK
TM7 275 294 DKLISLFYGVVTPMLNPIIY

The information was derived from a multiple alignment of ORs, based on the algorithms of Man et al. Protein Sci. 2004 Jan;13(1):240-54.
HORDE homepage