Protein information for: OR13C7P



MVSANQTASVTEFILLGLSAHPKLEKTFFVLILLMYLVILLGNGVLILMT
VSNSHLHMPMYFFLGNLSFLDICYTTSSVPLILDSFLTPRKTISFSACAV
QMFLSFAMGATECVLLSMMAFDRYVAICNPLRYPVVMSKAAYMPMKAAGS
WVAGSTASMVQTSLAMRLPFCGDNIINHFTCEILAVLKLACADISVNVIS
MGVTNVIFLGVPVLFISFSYVFIIATILRIPSAEGRKKAFSTCSAHLTVV
VIFYGTILFMYGKPKSKDPLGADKQDLADKLISLFYGVVTPMLNPIIYSL
RNKDVKAAVRDLIFQKCFA
In red: predicted N-glycosylation site.
In magenta: Conserved cysteines that are predicted to form a disulfide bond.
Underlined and bold: TM regions.

Predicted binding site residues (CDRs) are highlighted according to the following amino acid color code:
| | basic (H,R,K)
| | hydrophilic, no charge (Q,N,T,S)
| | aliphatic (M,A,I,L,V)
| | aromatic (F,Y,W)
| | helix breakers (G,P)
| | acidic (D,E)
| | cysteine (C)

Sequences of the TM regions:

TM

Start position

End position

Sequence

TM1 25 51 EKTFFVLILLMYLVILLGNGVLILMTV
TM2 62 84 FFLGNLSFLDICYTTSSVPLILD
TM3 99 119 AVQMFLSFAMGATECVLLSMM
TM4 143 163 MPMKAAGSWVAGSTASMVQTS
TM5 200 221 SMGVTNVIFLGVPVLFISFSYV
TM6 243 267 CSAHLTVVVIFYGTILFMYGKPKSK
TM7 279 298 DKLISLFYGVVTPMLNPIIY

The information was derived from a multiple alignment of ORs, based on the algorithms of Man et al. Protein Sci. 2004 Jan;13(1):240-54.
HORDE homepage