Protein information for: OR13D3P



METTNHSAVTEFFLVGLSQYPELQLFLFLLCLIMYMIILLGNSFLIIITI
LDSRLHTPMYFFLGNLSFLGICYTSSSIPPMLIIFVSERKSISFIGCALQ
MVVSLGLGSIECILLAVMAYDRYVAICNPLRYSIIMNRVLYVQMAAWSWI
IGCLTSLLRTVLTMMLPFCGNNIIDHLTCEILALLKVICSDISINVFIMT
VSSIVLLVIPLNFFSYVFILSSILRINSAEGRKKAFFTCSAHLTVVILFY
GSVLFMHMKPKSKFTTASDEIIGLSYEVITPMNPIIYSLRNKEIKEAVKK
ILSRHVHLWKI
In red: predicted N-glycosylation site.
In magenta: Conserved cysteines that are predicted to form a disulfide bond.
Underlined and bold: TM regions.

Predicted binding site residues (CDRs) are highlighted according to the following amino acid color code:
| | basic (H,R,K)
| | hydrophilic, no charge (Q,N,T,S)
| | aliphatic (M,A,I,L,V)
| | aromatic (F,Y,W)
| | helix breakers (G,P)
| | acidic (D,E)
| | cysteine (C)

Sequences of the TM regions:

TM

Start position

End position

Sequence

TM1 24 50 QLFLFLLCLIMYMIILLGNSFLIIITI
TM2 61 83 FFLGNLSFLGICYTSSSIPPMLI
TM3 98 118 ALQMVVSLGLGSIECILLAVM
TM4 141 161 YVQMAAWSWIIGCLTSLLRTV
TM5 198 217 IMTVSSIVLLVIPLNFFSYV
TM6 239 263 CSAHLTVVILFYGSVLFMHMKPKSK
TM7 269 287 DEIIGLSYEVITPMNPIIY

The information was derived from a multiple alignment of ORs, based on the algorithms of Man et al. Protein Sci. 2004 Jan;13(1):240-54.
HORDE homepage