Protein information for: OR13E1P



MKWANQTAVTEYVLMGLHEHCNLEVVLFVFCLGIYSVNVLGNALLIGLNV
LHPRLHNPMYFFSNLSLMDICGTSSFVPLMLDNFLETQRTISFPGCALQM
YLTLALGSTECLLLAVMAYDRYVAICQPLRYPELMSGQTCMQMAALSWGT
GFANSLLQSILVWHLPFCGHVINYFYEILAVLKLACGDISLNALALMVAT
AVLTLAPLLLICLSYLFILSAILRVPSAAGRCKAFSTCSAHRTVVVVFYG
TISFMYFKPKAKDPNVDKTVALFYGVVTPSLNPIIYSLRNAEVKAAVLTL
LRGGLLSRKASHCYCCPLP
In red: predicted N-glycosylation site.
Cysteines that are predicted to form a disulfide bond do not occur.
Underlined and bold: TM regions.

Predicted binding site residues (CDRs) are highlighted according to the following amino acid color code:
| | basic (H,R,K)
| | hydrophilic, no charge (Q,N,T,S)
| | aliphatic (M,A,I,L,V)
| | aromatic (F,Y,W)
| | helix breakers (G,P)
| | acidic (D,E)
| | cysteine (C)

Sequences of the TM regions:

TM

Start position

End position

Sequence

TM1 24 50 EVVLFVFCLGIYSVNVLGNALLIGLNV
TM2 60 82 YFFSNLSLMDICGTSSFVPLMLD
TM3 97 117 ALQMYLTLALGSTECLLLAVM
TM4 140 160 CMQMAALSWGTGFANSLLQSI
TM5 195 216 ALMVATAVLTLAPLLLICLSYL
TM6 238 262 CSAHRTVVVVFYGTISFMYFKPKAK
TM7 267 285 KTVALFYGVVTPSLNPIIY

The information was derived from a multiple alignment of ORs, based on the algorithms of Man et al. Protein Sci. 2004 Jan;13(1):240-54.
HORDE homepage