Protein information for: OR13I1P



MERTNXTTEFELILISLXVLISXQKLLFVTCLVVYLVTLLGNRIQIIPTL
LVSHLYLCHGNPSFLDIGLTSSFTPSILINFLSEGKKLSFTDCIIQMSIF
YSMGSTECVLLAVMAYDNCVVISKFLRYPLIINKKVLCVFMATVSYELGF
LNSTKCINSYIXMHFCGKHIINHFYKILQLMPLACIDISLNENIIILGKV
NFSFTLLLPFQFFIFSFLYFHHLCCIEINSAEGRKKVSSTCSAHITVVIV
FHRTILFMYIKSTSNGTTSEKLVDLFCGVVMLMLNLIIYSLGNMEVLGVM
KKLISMSRPWCWKND
In red: predicted N-glycosylation site.
Cysteines that are predicted to form a disulfide bond do not occur.
Underlined and bold: TM regions.

Predicted binding site residues (CDRs) are highlighted according to the following amino acid color code:
| | basic (H,R,K)
| | hydrophilic, no charge (Q,N,T,S)
| | aliphatic (M,A,I,L,V)
| | aromatic (F,Y,W)
| | helix breakers (G,P)
| | acidic (D,E)
| | cysteine (C)

Sequences of the TM regions:

TM

Start position

End position

Sequence

TM1 24 50 QKLLFVTCLVVYLVTLLGNRIQIIPTL
TM2 57 79 LCHGNPSFLDIGLTSSFTPSILI
TM3 94 114 IIQMSIFYSMGSTECVLLAVM
TM4 138 158 CVFMATVSYELGFLNSTKCIN
TM5 195 216 IILGKVNFSFTLLLPFQFFIFS
TM6 241 265 CSAHITVVIVFHRTILFMYIKSTSN
TM7 270 289 EKLVDLFCGVVMLMLNLIIY

The information was derived from a multiple alignment of ORs, based on the algorithms of Man et al. Protein Sci. 2004 Jan;13(1):240-54.
HORDE homepage