Protein information for: OR13K1P



MDILVIDNGSEVTEFILVGLYNHPKFQIAFYRTMVVVYLITFVGSSLIIV
VVKVDGWLHTPMCFFLSNLSFLDICYSSNSVPFLLFNGLRDYPTISYNSC
YAQMTSAFFLGMTGCLLLAVMAYERFVVISNPLRYIIIMNNKVCIQLAMV
TWASAFLMSLIQXLQXYIAIIHXLLMIRIAIPAHFCGHNVINHFTCEVQE
LLKLVCSDIPGSLILGLVIGIFTLSLPFTLPLFAYAHIVVAVLRINSAEA
RLKAFSTCGSHLTVIIIFYGTATYMYLKPQSRESQDEGKVISVFFLEKQH
QNDSISVFYGVVTPMLNPLIYTLRDKDAK
In red: predicted N-glycosylation site.
In magenta: Conserved cysteines that are predicted to form a disulfide bond.
Underlined and bold: TM regions.

Predicted binding site residues (CDRs) are highlighted according to the following amino acid color code:
| | basic (H,R,K)
| | hydrophilic, no charge (Q,N,T,S)
| | aliphatic (M,A,I,L,V)
| | aromatic (F,Y,W)
| | helix breakers (G,P)
| | acidic (D,E)
| | cysteine (C)

Sequences of the TM regions:

TM

Start position

End position

Sequence

TM1 27 53 QIAFYRTMVVVYLITFVGSSLIIVVVK
TM2 64 86 FFLSNLSFLDICYSSNSVPFLLF
TM3 101 121 YAQMTSAFFLGMTGCLLLAVM
TM4 144 164 CIQLAMVTWASAFLMSLIQXL
TM5 215 236 LGLVIGIFTLSLPFTLPLFAYA
TM6 258 282 CGSHLTVIIIFYGTATYMYLKPQSR
TM7 302 321 NDSISVFYGVVTPMLNPLIY

The information was derived from a multiple alignment of ORs, based on the algorithms of Man et al. Protein Sci. 2004 Jan;13(1):240-54.
HORDE homepage