Protein information for: OR13Z1P



YFIYLPIFISVEKEFKVVNQMVVTEFIFLNFSKHPALQMVFFLFSLVIYL
ISLLGNAVRVSPAFYTPVGYFLSHLSFLDICYMSTTILVMLVNFFQESKT
ISYEGCLSQIFFLALXASTEGVLLAAIAYDHCVAICHRLQYRLLMSGKVY
VCLVTGFWMCGLLNSGTHTALTATLTVCEPNPISCFLCAIPLLLKLSCSD
TCQXVCVHVVRATTGLSPCLFMAMSYIFIISTIFGTDHFNYDRPTEGCSL
DTDILVSVLFCVVTPVLNPITYSLRNKEIKGAVMRLTGKHEFSSEVTD
In red: predicted N-glycosylation site.
In magenta: Conserved cysteines that are predicted to form a disulfide bond.
Underlined and bold: TM regions.

Predicted binding site residues (CDRs) are highlighted according to the following amino acid color code:
| | basic (H,R,K)
| | hydrophilic, no charge (Q,N,T,S)
| | aliphatic (M,A,I,L,V)
| | aromatic (F,Y,W)
| | helix breakers (G,P)
| | acidic (D,E)
| | cysteine (C)

Sequences of the TM regions:

TM

Start position

End position

Sequence

TM1 38 59 QMVFFLFSLVIYLISLLGNAVR
TM2 70 92 YFLSHLSFLDICYMSTTILVMLV
TM3 107 127 LSQIFFLALXASTEGVLLAAI
TM4 150 170 YVCLVTGFWMCGLLNSGTHTA
TM5 192 211 LLLKLSCSDTCQXVCVHVVR
TM6 223 247 AMSYIFIISTIFGTDHFNYDRPTEG
TM7 253 272 DILVSVLFCVVTPVLNPITY

The information was derived from a multiple alignment of ORs, based on the algorithms of Man et al. Protein Sci. 2004 Jan;13(1):240-54.
HORDE homepage