Protein information for: OR13Z2P



LEISNQTYVTKFIFWVFSNHSNLQGLFFLVFLVIYLTLWENMLIMVATDL
ALHIPLYYLLSNLSFLDICYMSTTILVMLVNFFQEKKIISYEACLSQIFF
LASXASTEGVLLAAMAYDHCVAICHPLQYKLLMSEKFCLVTGFWMCGLVN
SGTHTALTATFILCKPNPISHFLCVIPFXLSS
In red: predicted N-glycosylation site.
Cysteines that are predicted to form a disulfide bond do not occur.
Underlined and bold: TM regions.

Predicted binding site residues (CDRs) are highlighted according to the following amino acid color code:
| | basic (H,R,K)
| | hydrophilic, no charge (Q,N,T,S)
| | aliphatic (M,A,I,L,V)
| | aromatic (F,Y,W)
| | helix breakers (G,P)
| | acidic (D,E)
| | cysteine (C)

Sequences of the TM regions:

TM

Start position

End position

Sequence

TM1 19 40 HSNLQGLFFLVFLVIYLTLWEN
TM2 53 74 HIPLYYLLSNLSFLDICYMSTT
TM3 89 109 ISYEACLSQIFFLASXASTEG
TM4 132 150 LMSEKFCLVTGFWMCGLVN
TM5 150 168 SGTHTALTATFILCKPNPI
TM6 182 181
TM7 182 181

The information was derived from a multiple alignment of ORs, based on the algorithms of Man et al. Protein Sci. 2004 Jan;13(1):240-54.
HORDE homepage