Protein information for: OR1AA1P



MHQGNXTTVSKFFLLGITTKPKEQQFIFMLFLCTYLVTMVRNLLIILAVV
SDAHLHGPIYFFLANLSFTNVCITTTTVPKILADIQSQNSTISFEGCPAQ
MXFXIFLVDLDNFLLVDMAYNXYIAICHPLHYTVVVLSPKNCALLVVTPW
VISNLVSILHLSLLSHLTFCISHIFYDLEPILGLACSDTQINNLIITAIG
EVVIFIPFTCHLVSYGLIGSTMLGVPSAKGKXKTFSTCGSHLSVVPVFYG
FIIGVYFLSFFAYSAERDEVAAIMYTTVTHLIKSFICSLRNEDMKGALRR
PLSRQGFSGVVSPAIEILVLT
In red: predicted N-glycosylation site.
Cysteines that are predicted to form a disulfide bond do not occur.
Underlined and bold: TM regions.

Predicted binding site residues (CDRs) are highlighted according to the following amino acid color code:
| | basic (H,R,K)
| | hydrophilic, no charge (Q,N,T,S)
| | aliphatic (M,A,I,L,V)
| | aromatic (F,Y,W)
| | helix breakers (G,P)
| | acidic (D,E)
| | cysteine (C)

Sequences of the TM regions:

TM

Start position

End position

Sequence

TM1 24 50 QQFIFMLFLCTYLVTMVRNLLIILAVV
TM2 61 83 FFLANLSFTNVCITTTTVPKILA
TM3 98 118 PAQMXFXIFLVDLDNFLLVDM
TM4 142 162 CALLVVTPWVISNLVSILHLS
TM5 195 216 IITAIGEVVIFIPFTCHLVSYG
TM6 238 262 CGSHLSVVPVFYGFIIGVYFLSFFA
TM7 268 287 DEVAAIMYTTVTHLIKSFIC

The information was derived from a multiple alignment of ORs, based on the algorithms of Man et al. Protein Sci. 2004 Jan;13(1):240-54.
HORDE homepage