Protein information for: OR1AB1P



WVSEFLLLGLLEELMLILFLSIFLVTGLKNLLILLIIPAIATDTRLSVRF
FLANLAFVVTCFTSTTIPKMLACKEIPCVMSGIPYAGCLTQMLFFIVLGI
HSFLLTAMANEHCVAICHSLNSIRSVTPXLCGLLVVASWTFAFRNALTHP
VLLTRLSLCTYEWVSHVFCNLSQLLKLACSDATLNNVTVQ
No N-glycosylation site was found.
In magenta: Conserved cysteines that are predicted to form a disulfide bond.
Underlined and bold: TM regions.

Predicted binding site residues (CDRs) are highlighted according to the following amino acid color code:
| | basic (H,R,K)
| | hydrophilic, no charge (Q,N,T,S)
| | aliphatic (M,A,I,L,V)
| | aromatic (F,Y,W)
| | helix breakers (G,P)
| | acidic (D,E)
| | cysteine (C)

Sequences of the TM regions:

TM

Start position

End position

Sequence

TM1 12 38 EELMLILFLSIFLVTGLKNLLILLIIP
TM2 50 72 FFLANLAFVVTCFTSTTIPKMLA
TM3 89 108 LTQMLFFIVLGIHSFLLTAM
TM4 131 151 CGLLVVASWTFAFRNALTHPV
TM5 160 176 YEWVSHVFCNLSQLLKL
TM6 190 189
TM7 190 189

The information was derived from a multiple alignment of ORs, based on the algorithms of Man et al. Protein Sci. 2004 Jan;13(1):240-54.
HORDE homepage