Protein information for: OR1B1



MMSFAPNASHSPVFLLLGFSRANISYTLLFFLFLAIYLTTILGNVTLVLL
ISWDSRLHSPMYYLLRGLSVIDMGLSTVTLPQLLAHLVSHYPTIPAARCL
AQFFFFYAFGVTDTLVIAVMALDRYVAICDPLHYALVMNHQRCACLLALS
WVVSILHTMLRVGLVLPLCWTGDAGGNVNLPHFFCDHRPLLRASCSDIHS
NELAIFFEGGFLMLGPCALIVLSYVRIGAAILRLPSAAGRRRAVSTCGSH
LTMVGFLYGTIICVYFQPPFQNSQYQDMVASVMYTAITPLANPFVYSLHN
KDVKGALCRLLEWVKVDP
In red: predicted N-glycosylation site.
In magenta: Conserved cysteines that are predicted to form a disulfide bond.
Underlined and bold: TM regions.

Predicted binding site residues (CDRs) are highlighted according to the following amino acid color code:
| | basic (H,R,K)
| | hydrophilic, no charge (Q,N,T,S)
| | aliphatic (M,A,I,L,V)
| | aromatic (F,Y,W)
| | helix breakers (G,P)
| | acidic (D,E)
| | cysteine (C)

Sequences of the TM regions:

TM

Start position

End position

Sequence

TM1 26 52 YTLLFFLFLAIYLTTILGNVTLVLLIS
TM2 63 85 YLLRGLSVIDMGLSTVTLPQLLA
TM3 100 120 LAQFFFFYAFGVTDTLVIAVM
TM4 143 163 CACLLALSWVVSILHTMLRVG
TM5 204 225 AIFFEGGFLMLGPCALIVLSYV
TM6 247 271 CGSHLTMVGFLYGTIICVYFQPPFQ
TM7 277 296 DMVASVMYTAITPLANPFVY

The information was derived from a multiple alignment of ORs, based on the algorithms of Man et al. Protein Sci. 2004 Jan;13(1):240-54.
HORDE homepage