Protein information for: OR1E2



MMGQNQTSISDFLLLGLPIQPEQQNLCYALFLAMYLTTLLGNLLIIVLIR
LDSHLHTPVYLFLSNLSFSDLCFSSVTMPKLLQNMQNQDPSIPYADCLTQ
MYFFLYFSDLESFLLVAMAYDRYVAICFPMHYTAICAIMSPMLCLSVVAL
SWVLTTFHAMLHTLLMARLCFCADNVIPHFFCDMSALLKLACSDTRVNEW
VIFIMGGLILVIPFLLILGSYARIVSSILKVPSSKGICKAFSTCGSHLSV
VSLFYGTVIGLYLCPSANSSTLKDTVMAMMYTVVTPMLTPFIYSLRNRDM
KGALERVICKRKNPFLL
In red: predicted N-glycosylation site.
In magenta: Conserved cysteines that are predicted to form a disulfide bond.
Underlined and bold: TM regions.

Predicted binding site residues (CDRs) are highlighted according to the following amino acid color code:
| | basic (H,R,K)
| | hydrophilic, no charge (Q,N,T,S)
| | aliphatic (M,A,I,L,V)
| | aromatic (F,Y,W)
| | helix breakers (G,P)
| | acidic (D,E)
| | cysteine (C)

Sequences of the TM regions:

TM

Start position

End position

Sequence

TM1 24 50 QNLCYALFLAMYLTTLLGNLLIIVLIR
TM2 61 83 LFLSNLSFSDLCFSSVTMPKLLQ
TM3 98 118 LTQMYFFLYFSDLESFLLVAM
TM4 144 164 CLSVVALSWVLTTFHAMLHTL
TM5 201 222 VIFIMGGLILVIPFLLILGSYA
TM6 244 268 CGSHLSVVSLFYGTVIGLYLCPSAN
TM7 274 293 DTVMAMMYTVVTPMLTPFIY

The information was derived from a multiple alignment of ORs, based on the algorithms of Man et al. Protein Sci. 2004 Jan;13(1):240-54.
HORDE homepage