Protein information for: OR1F2P



VCFXIHCLLCSWVQTYERDKPVSVSEFLLLGLSRQPQQQHLLFVFFLSMY
LATVLGNLLIILAISIDSRLHTPMYFFLSNMSFVDNCFSTTVPKMLANHI
LRTQTISFSGCLMQMYFISELADMDNFLLAVMAYDRFVAVCRPLHYTAKM
THQLCALLVTGSWVVANSNALLHTLLMARLSFCADNTIPHIFCDVTPLLK
LSCSDTHLSEVMILTEAALVTITPFLCLLASYMHITCVVLRVPSTKGRWK
AFSTCGSHLAVVLLFYGTIMSPYFRTSSSHSAQRDIAAAVRFTVVTPVMN
PLIYSLRNKDIKGALVKVVAVKFFSVQ
No N-glycosylation site was found.
In magenta: Conserved cysteines that are predicted to form a disulfide bond.
Underlined and bold: TM regions.

Predicted binding site residues (CDRs) are highlighted according to the following amino acid color code:
| | basic (H,R,K)
| | hydrophilic, no charge (Q,N,T,S)
| | aliphatic (M,A,I,L,V)
| | aromatic (F,Y,W)
| | helix breakers (G,P)
| | acidic (D,E)
| | cysteine (C)

Sequences of the TM regions:

TM

Start position

End position

Sequence

TM1 39 65 QHLLFVFFLSMYLATVLGNLLIILAIS
TM2 76 97 FFLSNMSFVDNCFSTTVPKMLA
TM3 112 132 LMQMYFISELADMDNFLLAVM
TM4 155 175 CALLVTGSWVVANSNALLHTL
TM5 212 233 MILTEAALVTITPFLCLLASYM
TM6 255 279 CGSHLAVVLLFYGTIMSPYFRTSSS
TM7 285 304 DIAAAVRFTVVTPVMNPLIY

The information was derived from a multiple alignment of ORs, based on the algorithms of Man et al. Protein Sci. 2004 Jan;13(1):240-54.
HORDE homepage